KEGG   Plasmodium vivax: PVX_086975Help
Entry
PVX_086975        CDS       T01073                                 

Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PVX_086975
Protein kinases [BR:pvx01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PVX_086975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 341 aa AA seqDB search
MIQFLKNLQLHKKKDSGSTKEPKRKNKMKYEDFNFIRTLGTGSFGRVILATYKNEDFPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYINHPFCVNLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVDTRTYTLCGTPEYIAPEILLNIGHGKAADWWTLGIFIYEILVGCPPFYANEPLLIYQK
ILEGIIYFPKFLDANCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKN
VDVPYKPKYKNVFDSSNFERVQEDLTIADKITNENDPFFDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcagtttttgaagaacctgcagctgcacaagaagaaggacagcggaagcactaaa
gagcccaagaggaaaaataaaatgaaatatgaggacttcaacttcattcggactcttggc
acaggctccttcggaagagtaatcctcgcgacgtacaagaatgaggacttccccccggtg
gccatcaagcgattcgagaaaagcaaaatcatcaagcagaagcaagtggaccatgtgttc
tccgagaggaagatcctcaactacatcaaccaccccttctgcgtcaacttgtatgggtcc
ttcaaggacgagtcctacttgtacctcgtgctggaattcgtaattgggggggagttcttc
accttcctcaggaggaacaagcgcttccccaacgacgtggggtgcttctacgccgcccag
atcgtcttgatatttgagtacctccagagtttgaacatcgtctacagggacctgaagcca
gagaacctcctgctggacaaggacgggttcatcaaaatgacggactttggatttgcgaaa
gtcgtagacacgcgcacgtacaccctgtgcgggacccccgagtacatcgcgccggagatc
ctcctcaacatcggccacggcaaggcggcggactggtggaccttgggcatcttcatctac
gaaatcctggtggggtgcccccccttctacgcaaacgagccgctgctgatttaccaaaag
attctggagggcatcatttacttccccaagtttttggacgctaactgcaagcacctcatg
aagaagctcctatcccacgacttaaccaaaaggtacggcaacctgaagaagggggcccaa
aacgtcaaggagcacccctggtttgggaacatcgattgggttagcttgctccacaaaaac
gtagatgtgccctacaagcccaagtacaaaaacgttttcgattcgtccaatttcgagcgg
gtgcaggaggacttgaccatcgccgataaaattaccaacgagaacgaccccttcttcgac
tggtag

DBGET integrated database retrieval system