KEGG   Plasmodium vivax: PVX_089200Help
Entry
PVX_089200        CDS       T01073                                 

Definition
histone acetyltransferase Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PVX_089200
Transcription machinery [BR:pvx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PVX_089200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1521 aa AA seqDB search
MMMEYLVNRERDPLWNDPSRHVLANKKEKKNEYSSHCCSKGREEDVDLWDFLKNKSGGFF
FESGGEKWVAELAPTGGAALGVVADAAAGAGFLGTPKRKRMQFESGGGMATPLQSYTPEG
GSHGLEDPPHGSPADGKRNEQKSEQKGERKGEHKGERKGERKAAWKKLKTGQLGSLSEFH
SRGYAAPPSEHVDQSEENDGARSQREEEEDVATTATTVLSLLQIERTPEGEDSSDDPPVS
GTEGYAFVGADQLVELPKRWQARSCMAEGNDCSGGDGAGNSSNGGGAGNSLSGGGSAGGS
GGSGGNHGSSGDDGKGNGNRGNGHLDGGHQGDNQEEEKEEGETNEQRKRKNGEDIMQGDI
TNGENALHMGGDPKMNYFPNGNGMVNGGLGIGGMGSGHNELGDQDRVAAGGQRKMPAGGN
YSNSSSMGMGIGMSMGKVESGPLNFASSNKIPLQSFGGPHPNGAKLGAEGGSAKNGAPLA
GNKNVGMNSLSGAMGGANMSFPKNKPFMANPQMGFVSNANGGVTKGSRMGESSRMNGPNF
KDPNDEYSLESKKKDAGKKEVLEGPLIGSDMSNYPNSAIGMGSNNMSMFPPHGMNTANAF
LGSNMGRMNSLSAMKGIGNQFNGVNVPPMMGAGGNSYNFHVAPPHPYAGMNMMNSIGMMG
SGVGNAAGIGGGFLPAGPMNEMHAGVMGGLDSNMANGLASGVANGLASGMTNGLNSPSRV
ASATQAAAPQSARNVGSKGVGSKGVGGKGVSGKSAGANGAETESAKKNNDAHPNSKGTNK
MNSNTEGNKSGIKNLRMEDLTFNEHVNLKSVDGLDLSKNFVNGKYCSRLPANEKIYNIVN
YIVRNSLVDYLLDFYNNESLLYNEKSELSDGNSGVDISPRCDELKGATKDGQEAEGEGAP
NVKEETGEENKGEACQGGEAPNGDHAKEEVKKQDGGAANEGAAEGLAGKQHADAQTPDEQ
LKSEGTPSQTNKQNVPSENISGNNRGEDKLDAVEVKEAPNKGETSPMVSSSGIGGGIGGG
SGGSVERDADESNKSILTEITKSICSIINLQQLMPVNNRVSNPNLIYDPHYDAIYSKWKS
FLRKEQSSGNVISMCFSRDFLHTVLLCNYVAIIEDLKKTAVKKKIKYFFLNLCLEAGLSV
NVALMLFINAAKQSNKLQSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDREPDHLI
KLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEIAF
LAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKERW
FGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKAIHFIKPQIIFKGLNFFMQNK
GVNNAIHPSNIPGLLEVGWKKEVKYFPKKAQNKDVQLKDQILGVLDFLEKQQSAWPFLKP
VSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIELKRMFDNCRLYNAPTTIYFK
YANELQALIWPKYECISDGGK
NT seq 4566 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggaatacctcgtaaacagggagagggatcctctttggaacgacccaagtcgt
catgttttggcaaataaaaaagaaaaaaagaatgaatattcctcccattgttgcagcaaa
gggagggaggaagatgtcgacctgtgggattttttgaaaaacaaaagcggtggatttttt
tttgagtcggggggggagaagtgggttgccgagctggcccccacggggggagcagcatta
ggagtagtagcagacgcagcagcgggagcaggcttcctggggacgcccaagaggaagcga
atgcagttcgagtccggcggcgggatggccacccccctgcagagttacacccccgagggg
gggagccacggtttggaagacccaccgcatggcagtcccgcagatggtaaaaggaatgag
cagaaaagtgagcaaaagggtgagcgaaaaggtgagcataaaggtgagcgaaaaggtgag
cgaaaagctgcgtggaagaagctgaagaccggccagttgggtagcctgagcgaatttcac
tccaggggatacgctgcaccgcccagtgagcatgtagaccaaagcgaagagaatgatggg
gctcgttcgcagagggaggaagaagaagatgtcgcaaccacggccactacagtgctgtca
ctattgcagattgaaagaactccagagggggaggactcgagtgatgatcccccagttagc
ggtacggaggggtatgcctttgtcggggcagaccaattggtggagttgcccaaaaggtgg
caggccaggagttgcatggcggaagggaacgactgcagtgggggggatggagcaggcaac
tcgtcgaacggtggtggggcaggcaactcactgagcggtggcggcagcgcaggggggagc
ggtggaagtggagggaaccacgggagcagtggagatgatgggaaaggaaatgggaacaga
ggaaatggtcacctggatggtggccaccagggggataaccaggaggaggagaaagaagag
ggagagacgaacgaacagagaaaacgtaaaaacggcgaagacatcatgcagggggatatt
acaaacggtgagaatgctctgcacatggggggggaccccaaaatgaattatttccccaac
gggaatggaatggttaatggggggctaggcatcggagggatgggcagtggtcacaacgaa
ctgggtgaccaggacagagtagcagctggcggtcaaaggaaaatgccagccggtggcaac
tacagcaatagcagcagcatgggcatgggcattggcatgagcatgggcaaggtggaaagt
ggccccctcaattttgcctcctccaataagataccgctacagagttttggtggcccccac
ccgaatggggcgaagcttggcgcggagggtggaagtgccaaaaacggggcccccctggcg
ggaaacaaaaatgtgggcatgaacagcttgagcggcgctatgggtggcgccaacatgagc
ttccccaagaataagcccttcatggcgaacccgcaaatggggtttgtgagcaatgcgaat
gggggcgtcaccaaggggtctcgcatgggcgaatcctcccgaatgaatggccccaacttc
aaagacccaaacgatgagtactccctggagagcaaaaaaaaggacgctggaaagaaggaa
gttctggagggacctttaataggcagcgacatgagcaactaccccaatagtgccatcggc
atgggaagcaataacatgagcatgtttccccctcatggaatgaacaccgcaaacgcattt
ttaggcagcaacatgggcagaatgaacagcctaagtgctatgaaagggattggtaatcag
ttcaacggtgtgaatgtaccaccgatgatgggtgccggtggtaactcctataacttccat
gtggctccgccccatccgtatgctggcatgaatatgatgaattccattgggatgatgggg
agcggtgtggggaacgccgccgggattggaggtggctttttgcccgcaggccccatgaat
gagatgcacgcgggggtgatgggcgggttggatagcaacatggcgaatgggttggctagc
ggtgtggcgaatgggttggccagcggcatgacgaacgggttgaacagccccagtagggta
gccagcgcgacgcaagcagcagccccccaaagcgccagaaatgtaggcagcaaaggggta
ggcagcaaaggggtaggcggcaaaggtgtaagcggcaaaagtgcaggcgccaacggagca
gaaaccgaaagtgcaaaaaaaaacaatgacgctcatccgaacagcaaaggaacaaacaaa
atgaatagcaacacagaaggtaacaagagtggaattaaaaatctgcgaatggaggacctt
acctttaatgagcatgtgaatttaaaaagtgtggatggacttgacttgagcaaaaacttt
gtgaatggaaagtactgctccaggctgcccgcgaatgaaaaaatttataacattgtaaat
tacattgtgaggaactccctcgtagattatctgctggacttttataacaacgagagtttg
ctttataatgagaaatccgagctgtcggatggcaacagcggggtggatatcagcccaagg
tgcgacgaactgaagggtgccacgaaggatgggcaggaggcagaaggggagggtgcccca
aatgtgaaggaggaaacgggggaggagaacaaaggggaggcgtgccaggggggagaggcc
ccgaacggtgaccacgcgaaggaagaggttaagaagcaggacgggggggctgccaacgag
ggggctgcagaaggactggcgggcaaacaacatgccgatgcgcagaccccagatgagcag
ctcaaaagtgagggcacccccagccagacgaataaacaaaacgtcccaagtgagaacatc
agtgggaataacaggggtgaggataagcttgacgcggtggaagtgaaggaggccccaaac
aagggagagacctcccccatggttagtagtagcggcattggcgggggcattggcgggggc
agcggcggaagcgtggagcgcgacgcggacgaaagcaacaagtccatcctgaccgaaatt
acgaaaagcatatgctccataataaatctacagcagctgatgccagtcaacaacagagta
agcaacccgaatttgatttatgatccccattatgatgccatttattctaagtggaaatcg
tttttaaggaaggagcagtctagtggcaatgtcatcagcatgtgtttctccagggacttt
ctgcataccgttttgctgtgcaattatgtggccataattgaggatttaaagaagaccgcc
gtgaagaagaaaataaaatacttttttctgaacctgtgcttggaggccgggctgtccgtc
aacgtcgccctcatgctcttcatcaacgcggccaagcagagcaacaagttgcagtccctc
ctgccatccgaaaccggccttggatacctgcatcgagacgccggaggagctaaagaagaa
aacatgggcatcatcaccttcgagtgcataacgaatgaccgcgaacccgatcacctaatc
aagctgatcactctgaagaatattttctctagacagttgccgaagatgcctcgagagtac
atcgtgcggttagtattcgatcggaatcattacacgttttgtcttttaaaaaagaacacg
gtaattgggggagtttgttttaggccctactttgagcagaagtttgcggaaattgccttt
ctcgcggttacctctacggagcaggtgaagggctacggcacgaggctgatgaaccacctg
aaggagcacgtgaagaagttcggcatcgagtacttcttgacgtatgcggacaacttcgcc
atcgggtacttccgcaagcaggggttctcgcagaagatctccatgccgaaggagaggtgg
ttcggctacatcaaggactacgacggaggaaccctaatggagtgctacatattcccaaac
ataaattacctccgactgtcggagatgctgtacgagcagaagaagacggtcaaaaaggcc
attcactttattaagccacaaattatttttaagggactcaacttctttatgcaaaataaa
ggagttaacaatgccattcacccgagtaacatcccagggttgctggaagtcgggtggaaa
aaggaggtgaaatatttcccaaagaaggcccaaaacaaggacgtacagctgaaggaccaa
attctgggcgtcctagacttcctggaaaagcagcagtccgcctggcccttcctcaagccc
gtcagcctctcggaggcccccgactactacgacattataaaggagcccacggacattctg
accatgcgcaggaaggcccgacatggcgagtacaaaaccaaggaggactttggaattgag
ctgaagcgcatgttcgacaactgccgcctgtacaacgcgcccacgacgatctacttcaag
tacgccaacgagttgcaggcgctgatatggcccaagtacgagtgcataagtgatggaggg
aagtga

DBGET integrated database retrieval system