KEGG   Plasmodium vivax: PVX_089655Help
Entry
PVX_089655        CDS       T01073                                 

Definition
ubiquitin carboxyl-terminal hydrolase a
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PVX_089655
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PVX_089655
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PVX_089655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 889 aa AA seqDB search
MADIKSVVASISASIREPSKDDVIYLDECSVTGLKDIFDEGVFVDLVSFESFSLKCLKYN
YSRAQQGGGEGPGSHAGSSHAGSSHAGSSHAGRFYLNVKKKKKLLDKIEKSEIKNLTLNV
EGGFKETRVYEYHCEYALYDVEANLYINLDEVEDERVKSICQSIISHKNELKKESPNKWV
NEIKESKYAKDLVQLPNITIKNENLECAVCKAKKNIWLNLSDGYIGCGRKIFNYGGGCLN
NEEGAALKHFYDSGKKYPLVVKLGTITKEGEADVFSYADDENDSVIDPYIDVHLKNLGIN
ITSLNKTEVTTLEKEIKENQNINFSSILDRDTQLVCKEGKVGFLNLGNTCYMNCALQVFL
SIKEVSYRYIGNQFDFLLTLNPKTKTHHDLFIQYAKLCCMIYKGDYISKKKNYIKKFKEE
CQERNVEVTYDSDVDEEDCVSINPSMFRTCLNQKGNPFCNNNQQDIFEFLTYLLNELIEN
ENVIFQRLLNGSNSNKRKIDQLESVEQGGAPEKEDKFKKSNNGSGGSGGVSDGEEQQKSE
KSIFNLFTFEMDQTIVSDEYNLSKSSFHNNILSLDIPLDSALLKSLEAESSPASPPQVTL
LDCLNHFIKKDHIEEYYSEEKKRKILAQKDIKFKSFPPYLFIHIKRFYADENWSAKKINI
PVQTDEYINLEFMRSEKSTPGGDNSSGYAEGQGKNSTGASHSGKSNEEHIMQQHKDLLDS
LLDLGFEKEKVLEAIKKVKVKNVNNCISYIYGEDSVELDLQEISQGTDVNSENLNSIVSM
GVNKNVAMASLLINKNDLQKSIDYIFSNLDALTESKCAAIVNRNKCEDGLANYELVASIV
HMGSNANSGHYICYIKDGSQWYVYNDNKIGLCDANKGKDTAYIHLYKRI
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcggacattaaaagcgttgtggcctccatttcggcgagcatccgcgagccgtcgaag
gatgacgtgatctacttggacgagtgcagcgtgaccggcctcaaggacatcttcgacgag
ggcgtgttcgtggacctggtttccttcgagagcttcagcctcaagtgcctcaagtacaac
tacagccgcgcgcagcagggcggcggcgagggcccgggcagccacgcaggtagcagccac
gcaggcagcagccacgcaggtagcagccacgcagggaggttctacctgaatgtgaagaag
aaaaaaaaactgctggacaagatagaaaaaagcgaaataaaaaacctgacgctgaacgtg
gaaggaggcttcaaggaaaccagggtgtatgagtaccactgcgagtatgccctgtatgat
gtggaggccaacctgtatatcaacctagacgaggtggaagacgagcgagtaaaaagcatt
tgccagagcataatcagtcacaagaatgagctgaagaaggagagccccaacaagtgggtg
aacgaaataaaggagagcaaatacgcaaaggaccttgtgcagctaccgaacattaccatc
aaaaatgaaaacctcgagtgtgccgtctgcaaagcgaagaaaaacatatggctgaaccta
tccgatgggtacattgggtgcgggaggaaaatattcaattacggagggggctgcctcaac
aatgaagaaggagcagcattaaagcatttctacgacagtggaaagaagtaccccctggtt
gttaaactaggaaccatcaccaaggagggagaagcagatgtgttctcctacgcagatgat
gaaaatgatagtgtaatagatccctacatagatgtgcatctgaagaacctaggaattaac
ataaccagtttgaacaaaacggaagttacaaccttggagaaagaaataaaagaaaatcaa
aatataaatttttcgtctatactggatagggatacacagctggtatgtaaagagggaaag
gttgggttcctcaatttaggaaatacatgctacatgaattgcgccttgcaagtgttcctc
tccatcaaagaggtcagctacaggtatataggcaaccaattcgacttcctcctaacccta
aaccctaaaacgaagacgcaccatgatttgttcattcagtatgccaaactgtgctgcatg
atttataaaggagattacattagcaagaaaaaaaattatataaaaaaatttaaagaagaa
tgtcaggagagaaatgtggaagtaacctacgacagcgatgtggacgaagaggactgtgtg
agcatcaacccgtcaatgtttcgaacgtgtttaaatcaaaaggggaaccccttctgcaac
aacaaccagcaggacatcttcgagtttttaacttacctcctgaatgagctgattgaaaat
gaaaatgtcatttttcagaggctgctaaacgggagcaactccaataagaggaaaatcgac
cagctggagagcgtcgagcaggggggggcgcccgaaaaggaggacaaatttaagaagagc
aacaatggaagcggaggtagcggcggagttagcgacggggaggagcagcagaaaagtgag
aaatccattttcaacctcttcaccttcgaaatggaccaaaccattgtgagcgatgagtat
aacctgagcaagagctccttccacaacaacatcctctccctggacatcccccttgatagt
gcccttttgaaaagtttagaagcagagagttcacctgcgtcccccccgcaagtgacgctg
ctagactgtctcaaccattttataaaaaaggatcacattgaggagtactacagtgaggag
aaaaaaaggaaaatcttggctcaaaaggatatcaaatttaagagcttccctccgtacctc
tttattcacattaaaagattctacgcagatgagaattggagcgctaagaagataaacatc
cccgtgcagacagatgaatacatcaatttggagttcatgcgatcggagaagagtacccct
gggggggataactccagtgggtatgcggaaggacaagggaagaactccactggtgcttcc
cattccgggaaaagcaacgaagagcacatcatgcaacagcataaggatctcttggactcc
ctgctagacctcgggtttgaaaaggaaaaagtgttggaggccatcaaaaaggtcaaagtg
aaaaatgtgaacaactgcatttcgtacatctacggggaagactcggtggagctggacctt
caagaaatcagccaggggacggacgtcaattcggaaaacttaaattccatcgtcagcatg
ggcgtcaacaaaaacgtggccatggcctccctcctcataaacaaaaacgacttgcagaag
tcgattgactacatcttttccaatctggacgccctcacggagagcaagtgcgccgcgatc
gtcaaccggaacaagtgcgaggacggcttggccaactacgaactcgtcgcgtccatcgtg
cacatgggaagcaacgccaactcgggccactacatctgctacataaaggacggttctcag
tggtacgtatacaacgacaacaagattggcctgtgcgacgcgaacaagggcaaggacacg
gcgtacatccacttgtacaagaggatctga

DBGET integrated database retrieval system