KEGG   Plasmodium vivax: PVX_089910Help
Entry
PVX_089910        CDS       T01073                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PVX_089910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1328 aa AA seqDB search
MKPKCSHKLSLASAEESKNEEIDREYYSCIKNCATDLQNLSLNFFPSINTYTCIPKINAI
NSITFHPCISSRDYFNNTYSFKPLFTHHFFSDSEQVGEPGEPSAHEREHPTASPLPPLYF
PPPLQVIGFDSLKIDFYYTCDNYEVFMKLSGSISDQYENSNYIMLMLLQNLYITTPYPGG
FIETEEEFLRILRRNEGVEGVEVVGPLERAGPVERNAQGRAKEKTKASGAKQSAALTQEQ
IYKPPGFIIYEKRLSDDIYLQIRKCGFSSKYFKLESVSNADEEEEEEEEEEEEEEEEEEE
EEEEEGEKPGEKPGEKLEANLGGTDGSVYQNGFADMVQNENTPSKDQPCSPPKTDRSKHK
RGSSVKETKSEHRKSSKGGEINSSCINQNDNHNIKRGLPNEPCEDDSKGEGNEAATPKYV
IHDDNCGSSTTSNEFNKEILRKKRYSKTSLVGSCTRSNEESLSSKEKIKKEKKTKEPPTH
PVVDGADCGNDNSPVELKKAKKNFTKHVTERDMSKLYRQYLRVVRAKRRNSLAARGDSLK
EKTPARRKLERQKCSGGSARGGAAVPVEENAAGNAAETAAETVAIPAAVPPAVSPAVPAS
IPAAVPPEMGAASESAAPLDSSSPKRGSPPKRGGSPKKACSPKRGSSPKKGGSPNQRASP
GKGGSANQAVEPPQGNAPHEKGTNSRRKKNVREELPGAKYDYTVKKNFELLHRKVEWFYH
WFIESASNIEYDYRWSVILPYIVFKHDEEKKFTENNFIENLNVQLLKNRSANVSVLPSVK
LEAAAPPSVAVSNEEVSPPMGKDVETGNKKKHKRGATAAVREKKQVKKRKKGQGGAAGEQ
TLECVGDRVGDRVGECFPEAANDLQSGREQPEGRVKKESSNKRENTQESHHDGHTEAVFD
QNEYVLTSEIVIKAIENTLKDVRSQDEEEYYAFHKNHDVIYLYSDLEKGGGEAATKGEAA
ARGAVQNTQAVTDVKGERKTTGRKGSAAEGGKEIPLKEEEPVEDVNEQDGEKKRKKSKNK
NEAKSEGKSEGKNEAQNEGTSEAKSETHNEGKHKSKDKRRDKQKSKAKRDAKGEDKKQSL
YYFYLFGLATTYTFFTFQFDRNRISQFLIFPPMQSKGLGMKVLEKIYHLSIVNSNVKEIT
VEDPAVSFTQLRDIITIKMCIDLRILSPTILYPSDYLKTKNIDKEYADLDKRKFMKVCKE
THKQITRMIETLLLAGVLPHPAPSYADIGEDKASGVRKKEKKNESPDSLNSMEHFESSDL
CKDVRIKIKKRIKNDYIGNLINKNMNCMASDVFQDYVMGRESQAKHHSLAVKEELYKLWK
KQCKVYYR
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaagtgcagccacaagctatccttggccagcgccgaggaaagcaaaaatgaa
gaaatcgacagggagtattacagctgtataaagaactgtgccactgatttgcagaatttg
tctttaaattttttcccctccataaatacgtacacgtgcattcccaaaataaatgccatc
aattcgataacctttcacccctgcatttcgagccgagattattttaacaacacgtattcg
ttcaagccgttgttcacgcaccacttctttagtgacagcgagcaggtgggcgagccgggc
gagccgagcgcgcacgagagggagcaccccaccgcttcgcctcttccaccactttacttc
cccccccccctgcaggtcatcgggttcgacagcctcaaaatagacttctactacacatgt
gacaactacgaagttttcatgaagctgagcgggtccataagtgaccagtatgaaaattcc
aactacatcatgctgatgcttttgcagaatttgtacatcacgacgccctacccgggtggg
ttcatcgagacggaggaggagttcctgcggattcttaggagaaacgaaggggtagagggg
gtagaagtggtggggccgctagaacgggcagggccggtagagcgaaatgcgcagggcagg
gcgaaggagaagaccaaagcgagcggcgccaaacaaagtgccgcactaacgcaagagcag
atttataaaccccccgggtttatcatttacgaaaaaagactcagtgatgatatttatttg
caaattaggaagtgtggcttctcttcgaagtattttaagttagaaagtgtcagcaatgcg
gacgaggaggaggaggaggaggaggaggaagaagaggaggaagaggaagaagaggaggag
gaagaagaagaggagggggagaagccgggggagaagccgggggagaagctggaagcgaac
ctgggaggcacagatggatctgtctaccaaaacggctttgcagatatggtccaaaatgag
aacaccccttctaaggatcaaccctgtagcccccccaaaaccgacaggagtaaacacaaa
agggggagctcagttaaggagacaaagagtgagcataggaagagttccaaaggaggagaa
attaacagcagttgcataaatcaaaatgataatcataacataaagaggggacttccaaat
gagccatgtgaggatgacagcaagggtgaagggaacgaagctgccacgccaaaatacgtc
atccatgatgataactgtgggagcagcacaacgtccaacgaatttaacaaagaaattctt
aggaagaagaggtactcgaaaacttccttggttggctcgtgcacgaggagcaacgaggag
tccctgtcgagcaaggaaaagataaaaaaagaaaagaagacaaaggagccccccacacat
cctgtagttgatggcgccgattgcggaaatgataactccccggtcgaattgaagaaggca
aagaagaacttcacgaaacatgttacggagcgggacatgtctaagctttaccggcaatac
ctgcgcgtcgtgagggccaagaggaggaacagcctcgccgcgaggggtgactccctgaag
gagaagacccccgctaggaggaagttggagaggcagaaatgttcgggggggtccgcgcgg
gggggcgcggctgtgcctgtcgaagagaatgcggcaggaaatgcggcagaaactgcggct
gaaacggtcgctatacctgccgctgtgccacccgctgtgtcacccgctgtacccgcctct
atacccgccgctgtaccccccgagatgggcgcggcgagcgagtcggcggcgccgctcgat
tcgagttccccaaagagaggaagtcctccaaagagaggaggttcgcccaaaaaagcgtgt
tcgccaaagagaggaagttcaccaaagaaggggggatcgccaaaccagcgagcctcacca
ggtaagggcggctccgcgaaccaagcagtagaacccccccaggggaacgcacctcacgag
aaaggaacgaacagcagaaggaagaaaaacgtgcgagaagaactccccggggctaagtac
gattacacagttaagaagaactttgagttgctacacagaaaggtggagtggttctaccac
tggtttatagaaagcgcctctaacatagaatatgactaccggtggagtgtcattttgccc
tacatagtgtttaagcatgatgaggagaagaagttcacagaaaataatttcatcgagaat
ttaaacgtgcagcttcttaagaaccgatccgctaatgtgagtgttcttccgagtgtcaag
ttggaggctgcggcccccccaagtgttgcagtcagcaacgaggaagtgtctcccccgatg
gggaaggatgtggagactgggaataagaagaaacacaagcgaggagcgacagctgcggtg
agggaaaagaagcaggtgaagaagaggaagaagggtcagggaggagcggcaggggagcag
acactcgagtgtgtaggagatcgtgttggagatcgcgtaggagagtgtttccccgaagcg
gcgaatgacctgcagagcgggagggagcaacccgaaggaagggtgaagaaggagagcagc
aataaaagggagaacactcaagagagtcaccacgatggccacacagaagcggtcttcgat
cagaacgagtacgtccttaccagcgagattgtcatcaaagcgattgaaaacactctgaag
gatgtgcggagtcaggacgaagaggagtattacgcatttcataaaaatcatgatgtcatt
tatttgtactccgatttggagaaaggcgggggggaggcagcaaccaagggggaggcggca
gccaggggggcagtgcaaaatacccaagcagtaaccgacgtgaagggggaaaggaagacc
acggggagaaaggggtccgcggctgaaggggggaaggaaatacccctcaaggaggaagag
ccggtggaagacgtaaatgagcaggatggagaaaagaagaggaaaaagagtaaaaacaaa
aatgaggctaaaagtgaaggcaaaagtgagggcaaaaatgaagcccaaaatgaaggcaca
agtgaagccaaaagtgaaacccacaatgaaggcaaacacaaaagcaaagacaaaaggaga
gataaacaaaaaagcaaagccaaaagggacgctaaaggcgaagataaaaaacaaagcctc
tactacttctatctcttcggattggccacgacctacacctttttcaccttccaatttgac
cgaaacagaatttcgcagtttttaatatttcccccgatgcagagcaaagggctggggatg
aaggtgctggagaagatataccacctatctattgttaattcgaatgtgaaagaaattact
gtagaggacccagcggtctcgttcacccagctgagggacatcatcaccatcaagatgtgc
atcgacttgaggattcttagccccaccatcctctacccaagtgattatttaaaaacaaaa
aatatagacaaggaatatgccgatttagataaaaggaaattcatgaaggtgtgcaaagag
acacacaagcagattactaggatgattgagactttgctcttggcgggtgttttgccgcac
cccgcccccagctatgcagatattggggaggataaagcctcgggcgttaggaagaaggag
aagaagaacgaaagccccgactccctcaattcgatggagcacttcgagtcctccgatttg
tgcaaagacgtgcgcatcaagattaagaagcgcatcaaaaatgactacattggcaatttg
attaacaagaatatgaactgcatggcgagcgacgtcttccaggactacgtaatggggagg
gagagtcaggcaaagcatcactcattagcggtcaaggaggagctttacaaactttggaag
aagcagtgcaaggtctactacaggtga

DBGET integrated database retrieval system