KEGG   Plasmodium vivax: PVX_089950Help
Entry
PVX_089950        CDS       T01073                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase 1
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pvx  Plasmodium vivax
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PVX_089950
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVX_089950
   00670 One carbon pool by folate
    PVX_089950
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PVX_089950
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PVX_089950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5
AA seq 624 aa AA seqDB search
MEDLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFSSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSSWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRINGAYPCDVFFPEFDESQFRVTSVSEVYNSKGTTLDFLVYSKVGG
GVDGGASNGSTADSASENCNALNCNAPKCSAPNCRSPNGGTAQQGEWGKGPAACPWQKNN
AEAEEDDLVYFSFNNKVGEKNPEHLQDFKIYNSLKIKQHPEYQYLGIIYDIIMNGNKQGD
RTGVGVMSKFGYMMKFNLSEYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIW
EANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMHDNYEDKGVDQLKNVIHLIK
NEPTSRRIILCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIAS
YSIFTHMIAQVCNLQPAQFIHILGNAHVYNNHVDSLKVQLNRIPYPFPTLKLNPEVKNIE
DFTISDFTIENYVHHDKIAMEMAA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggaggacctttcagatgtatttgacatttacgccatctgcgcatgctgcaaggtcgcc
cccaccagtgaagggacaaagaatgaaccgttcagcccgcggacctttaggggtctgggc
aataaggggactctcccatggaaatgcaactccgtcgatatgaagtacttcagctcggtg
acgacctacgtggatgagtcaaagtatgagaagctaaagtggaagagggagaggtaccta
cgaatggaagcctcacagggggggggtgacaacacaagcggtggtgacaacacacacggt
ggtgacaacgccgacaagctgcaaaacgtcgtggtcatggggagaagcagctgggagagc
atccccaagcagtacaagccgctcccaaacagaatcaacgtcgtgctttccaagacgcta
acaaaggaagacgtgaaggaaaaggtcttcataattgacagcatagatgacctactgctg
ctcttaaagaagctgaagtactacaaatgcttcatcattgggggagcacaagtttatagg
gaatgcctaagtagaaacttaatcaagcagatctacttcacgaggatcaacggcgcctac
ccgtgtgacgtcttcttccccgagtttgacgaaagccagtttcgggtgacgtccgtcagt
gaggtgtacaacagcaagggcaccactctggactttttggtttacagcaaggtggggggg
ggagttgacgggggcgcctccaacgggagcactgcggacagcgcttcggagaactgcaat
gcgttgaactgcaatgcgccgaaatgtagcgccccgaactgccgctcccccaatgggggg
accgcacagcagggcgaatggggaaagggccccgccgcgtgcccgtggcagaagaacaac
gccgaggcagaggaagacgacctcgtgtacttcagctttaacaacaaagtgggggagaaa
aacccggagcacctgcaagattttaaaatttacaacagcctgaagattaagcagcaccca
gagtaccaatacctaggcatcatatacgacatcatcatgaatggaaacaaacaaggagac
agaacaggtgtgggagtgatgagcaaatttggctacatgatgaaatttaatttaagtgaa
tacttccccctattaacaacaaagaagttatttttgaggggaataattgaggaactgctt
tggttcattcgaggagaaacaaacggaaacactttgttaaataaaaacgtgaggatatgg
gaagcaaatggaacgagggagttcctcgacaacaggaaattattccacagagaagtgaat
gacttggggcccatttatggcttccagtggagacacttcggtgctgaatacacaaatatg
catgacaattacgaagataaaggtgtagaccaattaaaaaatgttattcatttaataaaa
aatgaaccaacaagtaggagaattattttgtgtgcatggaatgtaaaagatttggatcaa
atggctttacctccttgtcatattttatgccaattttacgttttcgatgggaaactatca
tgcattatgtaccagaggtcttgtgacttgggtcttggggtccccttcaacatcgcttcg
tattccatattcacacacatgattgcgcaggtgtgcaatttgcagcctgcacagttcata
cacattttgggcaacgcgcacgtctacaacaaccatgttgacagcttgaaagtgcagctg
aacaggatcccctacccgttcccaacgcttaaactgaacccggaggtgaagaacattgag
gattttaccatttcggatttcacaatagagaattacgtgcaccacgataaaatcgccatg
gagatggccgcctag

DBGET integrated database retrieval system