KEGG   Plasmodium vivax: PVX_090935Help
Entry
PVX_090935        CDS       T01073                                 

Definition
histone 2B
Orthology
K11252  
histone H2B
Organism
pvx  Plasmodium vivax
Brite
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PVX_090935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 118 aa AA seqDB search
MVSKKPAKAKKATTGATDGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFL
VDTFEKIATEASRLCKYTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatccaaaaagccagcgaaagcgaaaaaagccaccactggtgcaactgacggaaag
aagaagagaaaaaagtccagatatgacagctatggactttacatttttaaagttttgaaa
caagttcacccagacactggtatttcgaggaaatccatgaacatcatgaactccttcctt
gttgatacttttgagaaaattgcaactgaagcttccagattgtgtaaatacaccagaagg
gacaccttatcatcccgtgaaattcaaactgccatcagattagtattgccaggagaattg
gccaagcacgccgtttcggaaggaaccaaggccgttacgaaatttacctccaagtaa

DBGET integrated database retrieval system