KEGG   Plasmodium vivax: PVX_091485Help
Entry
PVX_091485        CDS       T01073                                 

Definition
ubiquitin C-terminal hydrolase, family 1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pvx  Plasmodium vivax
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 506 aa AA seqDB search
MQRSSNEGLSEWCLIESNPCIFNDMLSRMGAKHLSVEDVYDLEFFDDYIYNRDVVSVEHV
LSIELYKTEKEKEKEREEREEQKEREEREEQKEQNAADGSTGGGAPPKREMYRNTAETDE
KYYRLIRNENSIFGIIFLFNIGKSYKRNKFVEHSVPENLFFAKQVIPNACATQAILSIVL
NIGVELNEEIKNIKSFSNNFDSSMKGLTLSNCNFLRNIHNTYKPPIYIEKENLHDEKGKN
NDSFHFVSYIQFGGSVYMLDGLQEGPVLIGQTGGADGRRSWVDLAREHIKKEIDEICGVS
GGSGVSGGVGGSSGGRGGSGGGDGRFNILIVVKDKEYLLKEFYKIHRILYKRLFTKLRSL
GVKEELLLDPVHDKINDQLSEEISAEMNGQVSGQANGQANGQANVQANGQVIEEKFNYAN
IPTVEELPDNIGELLTTFHKSQFEINYLQALLQEQKQLKRSSKKELAFKYFNFYPFVMSS
LKLMAKHKFLKEAYQKQKQKRRRAIA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaagcagcaacgagggcctgagcgaatggtgcctgatcgagagcaacccctgc
atcttcaacgacatgctgagccggatgggcgcgaagcacctctccgtggaggacgtgtac
gatttggagttcttcgacgactacatctataacagggatgtggtcagcgtggagcacgtc
ctcagcatcgagctgtacaaaacggagaaggagaaggagaaggagcgggaggagcgggag
gagcagaaggagcgggaggagcgggaggagcagaaggagcagaatgccgctgatggaagc
accgggggaggggcgcccccgaaaagggagatgtaccgaaacacagccgaaacggacgaa
aagtactaccggctcataagaaacgaaaacagcatttttggaattattttcctttttaac
atcgggaagagctacaagaggaacaagttcgtggagcacagtgtgccagagaacctcttc
tttgcaaagcaggtgatcccgaacgcatgtgccacgcaagcaatcctgtctattgtccta
aatataggggtagaactgaacgaagaaataaaaaacatcaaatcgtttagcaataacttt
gatagctcgatgaaggggctcaccctctccaactgtaacttccttcgaaacatccacaat
acgtataagcctcccatatatatagaaaaggagaacctgcatgacgaaaagggaaagaac
aacgactccttccacttcgtttcgtatatacaatttggcgggagtgtctacatgctggac
ggcctgcaggaggggcccgtgctcatcgggcagaccgggggcgcggacggccgccgcagt
tgggtcgacctcgccagggagcacatcaagaaggagatcgacgagatatgcggggttagc
ggtggtagcggagttagcggcggtgtgggtggaagcagcggtggccgtggcggcagcggt
gggggggacgggcggttcaacatcctaatcgtggtgaaggacaaggagtatttgctcaaa
gagttttataaaatccacagaattttgtataagagactcttcaccaagttacgcagcctg
ggggtgaaggaggaattattactggacccagtacacgataaaataaacgaccaactgagc
gaagagataagcgcagaaatgaacggccaagtaagcggccaagcaaacggccaagcgaac
ggccaagcaaacgtccaagcgaacggccaagtaatcgaagaaaagtttaactacgcgaat
atccccaccgtggaggagctcccagacaatatcggagagctgctgaccactttccataag
tcccaatttgaaatcaactacctgcaggcccttttgcaggagcagaagcagttgaagcgc
tcctcgaagaaggagctggccttcaaatattttaatttctaccccttcgtgatgtcctct
ttgaagctcatggccaagcacaagttcttgaaggaggcctaccagaagcagaagcagaag
cgcaggcgggccatcgcctag

DBGET integrated database retrieval system