KEGG   Plasmodium vivax: PVX_091640Help
Entry
PVX_091640        CDS       T01073                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_091640
   01230 Biosynthesis of amino acids
    PVX_091640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_091640
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PVX_091640
Enzymes [BR:pvx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PVX_091640
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PVX_091640
  Exosomal proteins of melanoma cells
   PVX_091640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEQGEQEAIAAGNYLKEKNFRFDVVYTSVL
KRAITTTWNVLKTGDMLHVPVIKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDSRWPGHNVVYKNVPKDTLPFTECLKDTVERVLPFWFDHIAPDILANKKVL
VSAHGNSLRGLVKHLDSLTEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatacacgttggttctactaaggcatggtgaaagcacttggaacaaggagaac
aaattcaccggctggacggacgtgcccctgagtgaacagggagagcaggaggccatagcc
gcgggaaactacctgaaggagaagaacttccgcttcgacgtggtgtacacgtcggtgctg
aagagagccatcaccaccacatggaatgtgctcaagacgggagacatgctgcacgtccca
gttattaaaacgtggagactaaacgaaaggcattacggatccctacaaggactcaacaaa
tcggaaacagccaaaaaatacggagaggaacaagtaaaaatttggaggagatcctatgac
atccctcctcctaagctagacaaagaggatagtaggtggccaggacacaacgtcgtttat
aagaacgtgccaaaggatacgctaccctttacagaatgtttgaaggacaccgtcgaaaga
gttttgcccttctggttcgatcacatagcacctgatattttggcaaataaaaaggtcctc
gtgtctgcacatggaaatagcttgagagggctagtgaaacatttggatagcttaactgaa
gctgacgtgttggagctgaacatccccacgggtgttcccctagtctacgagttagatgaa
aatctgaagcccattaaacattactacttgctggacagcgaggagctcaagaagaaaatg
gacgaagtggccaaccaggggaaggccaagtga

DBGET integrated database retrieval system