KEGG   Plasmodium vivax: PVX_092315Help
Entry
PVX_092315        CDS       T01073                                 

Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pvx  Plasmodium vivax
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PVX_092315
Enzymes [BR:pvx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PVX_092315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 424 aa AA seqDB search
MKPVGPLICSLVLLAGLCPRHASGLYTNVKEIQTVESPQEFEELLSAKKVCLVEFYATWC
RTSRGFANDFTSIAKTIKDDITILAVKNEDIINQYKIETYPSIHIFFAKDGKKKMEKFDG
NYKIKEVVSFVYDSIKKNRLKELNIDLDEMNKSSYKKKGKKKNDGKVIILNDSNFDSSVL
QDDENVWFVFFYAPWCGHSKPIHPMFDQLAKKVAHLKNARIAKIDATVEQRSAQTYQIRH
YPSFRLFPSGKKKSHSAVDYNDSRTVEDMYQFFLKYYTEKKEVIQLTSQQVFDEYCEKDV
CLLAILPNKEDTELSYFKSYVQILTNVIKDVSRLPVTLLWTQAGDQLDIVQKLNLTFGFP
TVIAISFSKNVYSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFTVKTVPKFSFASAGEA
NSEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgtgggccccctaatttgctcgctggtgctcctggcgggcctgtgccccagg
cacgcctcggggctgtacacaaatgtgaaggaaatccaaacggtggagagcccccaagag
ttcgaggagttgctaagcgcgaaaaaggtttgcctagttgaattttacgcaacgtggtgc
aggacctccagggggtttgcgaacgacttcacgagcatagccaagacgataaaagacgac
ataaccattttggcggtaaaaaatgaagatataattaaccagtataaaattgaaacgtac
ccaagtatacacattttcttcgcaaaggatggtaaaaaaaaaatggagaaatttgatggc
aattacaaaataaaagaagtggtttcctttgtatatgatagtatcaaaaagaaccgtttg
aaagagctaaatatcgacctggacgaaatgaataaaagctcttataaaaaaaaaggaaag
aaaaaaaacgatggcaaagtaattatactaaatgatagcaattttgatagcagtgtttta
caggatgatgagaacgtctggtttgtctttttctacgccccttggtgtggacacagcaag
ccgatacaccccatgtttgaccaactagcaaaaaaagtagctcatttgaagaacgcccga
attgccaaaatagacgctacagtggaacaacgatccgcgcaaacttatcaaataaggcac
tacccatcttttaggctattcccctcaggaaagaaaaaatcacatagtgctgtagattat
aacgactctagaacggtagaggatatgtatcaattttttttaaaatattacacagaaaag
aaggaagtaattcagctaacctctcaacaagtgtttgacgaatattgcgagaaagacgta
tgtctcttagccattttaccaaacaaagaagacaccgaactgagttatttcaaatcctat
gtgcagatactcaccaatgttattaaagacgttagtaggttaccagtcactttgttgtgg
acccaagcaggagaccaactagacattgtgcagaagttaaatctcactttcggtttcccc
actgttattgccattagcttttcgaaaaatgtctattccattttgaaggggaattattct
gagcagtccatcaaaaatttcatcactcaaatgatgatgggcaaatcttctgtcgacaat
ttggttccctttacggtgaagacggtccccaagtttagtttcgccagtgcgggggaggcc
aactcggagttgtga

DBGET integrated database retrieval system