KEGG   Plasmodium vivax: PVX_095010Help
Entry
PVX_095010        CDS       T01073                                 

Definition
ribonucleotide reductase small subunit
Orthology
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
pvx  Plasmodium vivax
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PVX_095010
   00240 Pyrimidine metabolism
    PVX_095010
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PVX_095010
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     PVX_095010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 335 aa AA seqDB search
MDKEHYHDQEVLLDAQNNDDILKENQFRWVMFPIKYKTFWSYYKEIESLFWTAEDYNFDK
DKKFLESIDKNMLVKLFELICFYSLKDLHVYEEQALITSKMLDIIQIPEGRAFYGFQMCM
ENIHDEVYACIFETYIPDAKQKRVIINKVIQLDSVLKKQKWLTELFETNIPFYNKLVLIY
ISKVLFNGTLNILIGYCKENSILPCLCNVHEKIHRDEYLHGDFSVMCCNHLNNKLKYESL
LDYFKMAVELEYQFSMEMLELSVLKIKKEQVKSFLEYLADTMLVNLKHPKYFNSKYPFTW
PEFNKIVVSENQKAESVKKTGDIYGERQIVLDEDF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagagcattatcacgaccaggaagtgctgctggatgcccaaaacaatgacgac
attttgaaggagaaccagttcagatgggttatgttccccatcaaatacaaaacgttctgg
agttactacaaagagatagaatccctcttctggacggccgaggactacaacttcgataag
gacaagaagttcctggagagcattgacaagaacatgctcgtgaagctgttcgagctgata
tgcttctacagcttaaaggacctccacgtatacgaggagcaggcgctgatcacgagcaaa
atgctggacatcattcagatccccgagggccgcgccttttacggcttccaaatgtgcatg
gaaaatatccacgacgaagtgtacgcatgcatcttcgaaacgtacatcccagacgcaaag
caaaaaagggtcatcatcaacaaagtcatacagctagacagtgtgttgaagaaacaaaaa
tggctaaccgaattgttcgaaacaaatatccccttctacaacaaacttgtccttatctac
atatccaaagtccttttcaacggcacgttaaatatcctcattggatactgtaaagagaat
tccatcctcccctgtttgtgtaatgtgcatgagaagattcaccgggatgagtacctgcat
ggagacttctccgttatgtgttgcaatcatttgaacaacaaattgaaatatgaaagcctt
ttggattacttcaaaatggctgtggagctggagtaccagttttccatggagatgctggag
ctgtccgttttgaaaataaagaaggagcaggtgaagtcttttctggagtacctagccgat
accatgctcgtcaatttgaagcaccccaagtattttaattccaagtaccccttcacctgg
cctgagtttaataagatcgtggtgagcgagaaccagaaggcggaatcggtcaagaagacg
ggggacatttacggagagagacagatcgtcctggacgaggacttctaa

DBGET integrated database retrieval system