KEGG   Plasmodium vivax: PVX_095295Help
Entry
PVX_095295        CDS       T01073                                 

Definition
(RefSeq) triosephophate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvx  Plasmodium vivax
Pathway
pvx00010  Glycolysis / Gluconeogenesis
pvx00051  Fructose and mannose metabolism
pvx00562  Inositol phosphate metabolism
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
pvx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_095295
   00051 Fructose and mannose metabolism
    PVX_095295
   00562 Inositol phosphate metabolism
    PVX_095295
Enzymes [BR:pvx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PVX_095295
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PVX_095295
  Exosomal proteins of bladder cancer cells
   PVX_095295
  Exosomal proteins of melanoma cells
   PVX_095295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5473814
NCBI-ProteinID: XP_001614525
UniProt: A5K7N9
Position
8
AA seq 389 aa AA seqDB search
MRKRLLCALCIYWVGTECLRFSECLPDGSSVDPLKAKEVRSFYLRARPLLKGRKRRRSQR
SSACRISNLDSPYEYPNKVVEMCPLVDNHAGAREGAVTHSQGSSQYISQGNSQGSSQGSS
RSGYPKGRKIIIGNWKCHLSKAEAYRLIDAFTKIKYSNNVDLVLSPNLLFMPYLLQKIEE
NDSKIFACSQDVSLASGLGAFTGETTATLIKHFGNEYTIIGHSERRRGFCSNGETLEQTA
QKVHNAVQSQLKVILCVGDDYQNEDRPFTSSKTRTLLSLIKQTIPKEHMQSIVIALEPSF
AVGTGKPVSADFLNTCYWDIKRNLAEEVDAQTSDAVKIVYGGSVTRHNMENYLEKTPVDG
FLIGKGSLDETFMDIVKYVDQSCVKLGSV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcgactgctgtgcgcgctatgcatctactgggtaggcacagaatgcttgcgc
tttagtgagtgtctgccggacggttcctccgttgaccccctcaaagcgaaggaggtgcgt
tccttctacctccgcgcaaggcccctcctaaaaggaaggaagagacgacgcagccagagg
tccagtgcctgcaggataagcaatttagactctccatatgaatacccaaataaggtggtg
gagatgtgcccgcttgttgacaaccatgcgggcgccagggagggagcggtgactcattcg
cagggcagttcgcagtacatttcgcagggcaactcgcagggcagctcgcagggcagctcc
cggagtggctaccctaaagggaggaaaatcatcatcgggaactggaagtgccacctctcc
aaggcagaagcatacagactcatcgacgcttttaccaaaataaaatactccaataatgtg
gaccttgttttatcccctaacttattattcatgccgtatctgctgcaaaaaattgaagag
aatgactcgaagatctttgcctgctctcaagacgtcagcctggcaagcggcctgggggcc
ttcaccggagaaaccacagccactttaataaagcactttggaaatgaatataccataatt
ggacacagcgagaggcgcagagggttttgcagcaatggggagacactagaacagacagct
cagaaggttcacaacgctgtgcagagccagctgaaagttatcctgtgcgtcggggatgat
tatcaaaatgaggaccgcccattcacgtcatccaagacgaggacactcctttccctcatc
aagcagacaattccgaaggagcacatgcaaagcattgtcatagccctggagcccagcttc
gccgtcggcactgggaagcccgtgtcggctgactttttgaacacctgctactgggacatc
aagcgaaacctagcagaagaggtggacgcgcaaacaagcgacgcggtgaaaatcgtctac
ggtggatcggtgacccggcacaacatggagaactacctggaaaagacccccgtcgatggg
ttcctcataggaaagggctcactggacgagaccttcatggacatcgtaaagtacgttgac
caaagttgcgtcaaactcggttcggtttag

DBGET integrated database retrieval system