KEGG   Plasmodium vivax: PVX_095295Help
Entry
PVX_095295        CDS       T01073                                 

Definition
triosephophate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_095295
   01230 Biosynthesis of amino acids
    PVX_095295
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_095295
   00051 Fructose and mannose metabolism
    PVX_095295
   00562 Inositol phosphate metabolism
    PVX_095295
Enzymes [BR:pvx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PVX_095295
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PVX_095295
  Exosomal proteins of bladder cancer cells
   PVX_095295
  Exosomal proteins of melanoma cells
   PVX_095295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 389 aa AA seqDB search
MRKRLLCALCIYWVGTECLRFSECLPDGSSVDPLKAKEVRSFYLRARPLLKGRKRRRSQR
SSACRISNLDSPYEYPNKVVEMCPLVDNHAGAREGAVTHSQGSSQYISQGNSQGSSQGSS
RSGYPKGRKIIIGNWKCHLSKAEAYRLIDAFTKIKYSNNVDLVLSPNLLFMPYLLQKIEE
NDSKIFACSQDVSLASGLGAFTGETTATLIKHFGNEYTIIGHSERRRGFCSNGETLEQTA
QKVHNAVQSQLKVILCVGDDYQNEDRPFTSSKTRTLLSLIKQTIPKEHMQSIVIALEPSF
AVGTGKPVSADFLNTCYWDIKRNLAEEVDAQTSDAVKIVYGGSVTRHNMENYLEKTPVDG
FLIGKGSLDETFMDIVKYVDQSCVKLGSV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcgactgctgtgcgcgctatgcatctactgggtaggcacagaatgcttgcgc
tttagtgagtgtctgccggacggttcctccgttgaccccctcaaagcgaaggaggtgcgt
tccttctacctccgcgcaaggcccctcctaaaaggaaggaagagacgacgcagccagagg
tccagtgcctgcaggataagcaatttagactctccatatgaatacccaaataaggtggtg
gagatgtgcccgcttgttgacaaccatgcgggcgccagggagggagcggtgactcattcg
cagggcagttcgcagtacatttcgcagggcaactcgcagggcagctcgcagggcagctcc
cggagtggctaccctaaagggaggaaaatcatcatcgggaactggaagtgccacctctcc
aaggcagaagcatacagactcatcgacgcttttaccaaaataaaatactccaataatgtg
gaccttgttttatcccctaacttattattcatgccgtatctgctgcaaaaaattgaagag
aatgactcgaagatctttgcctgctctcaagacgtcagcctggcaagcggcctgggggcc
ttcaccggagaaaccacagccactttaataaagcactttggaaatgaatataccataatt
ggacacagcgagaggcgcagagggttttgcagcaatggggagacactagaacagacagct
cagaaggttcacaacgctgtgcagagccagctgaaagttatcctgtgcgtcggggatgat
tatcaaaatgaggaccgcccattcacgtcatccaagacgaggacactcctttccctcatc
aagcagacaattccgaaggagcacatgcaaagcattgtcatagccctggagcccagcttc
gccgtcggcactgggaagcccgtgtcggctgactttttgaacacctgctactgggacatc
aagcgaaacctagcagaagaggtggacgcgcaaacaagcgacgcggtgaaaatcgtctac
ggtggatcggtgacccggcacaacatggagaactacctggaaaagacccccgtcgatggg
ttcctcataggaaagggctcactggacgagaccttcatggacatcgtaaagtacgttgac
caaagttgcgtcaaactcggttcggtttag

DBGET integrated database retrieval system