KEGG   Plasmodium vivax: PVX_095480Help
Entry
PVX_095480        CDS       T01073                                 

Definition
translation initiation factor E4
Orthology
K03259  
translation initiation factor 4E
Organism
pvx  Plasmodium vivax
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PVX_095480
Messenger RNA biogenesis [BR:pvx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PVX_095480
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PVX_095480
Translation factors [BR:pvx03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PVX_095480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 227 aa AA seqDB search
MKYLTFNRSNKDAIDLCEKLEATKIDLANPLLLQYSWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLAQKSMTRLSEDGTLRIIDALMIFRDNIQPMWEDPAN
SEGGHFEYKFVPRDFPYSQIDEFWNNLVLAIIGCTLKHYNLITGIRLVDKLSTTRHGYVR
IEIWYTTVPDDSVRNHLRKDLEEHMCNRIDGSHVYPPRGKNFGHSHK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctaacttttaacagaagcaataaggacgcaatcgacctgtgtgaaaagcta
gaagcaacaaagatagacctcgcgaacccactgctactacaatacagttgggtcatatgg
gaacaagtgtcagacaacaaaattaaacaaagtaataactataaggattacacaaggcca
ttggcaaaatttaatagtgtacagaaattctggcaactatggaacagattacctcagcca
agtgaccttcttgcacagaagagtatgacgaggctatcggaagatgggactcttcgcatt
atagatgccctcatgatttttcgagacaatattcaacccatgtgggaagacccagcgaat
tctgaaggtggtcattttgagtataaatttgtaccaagggattttccatacagtcagata
gacgaattttggaacaaccttgttttggccatcattgggtgcactttaaaacactacaat
ttaataacagggattaggctagtagataaattaagcacgacgcgtcatgggtacgtaaga
atagagatttggtacacgacggtgccagacgatagtgttagaaaccacctgaggaaggac
ctggaggagcacatgtgcaatcgtattgacggctcgcacgtctatcccccaagggggaag
aacttcggccactcgcacaagtag

DBGET integrated database retrieval system