KEGG   Plasmodium vivax: PVX_097660Help
Entry
PVX_097660        CDS       T01073                                 

Definition
4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pvx  Plasmodium vivax
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PVX_097660
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PVX_097660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 507 aa AA seqDB search
MRFGLTVKGVLLLCVRLLHTIVVSKNVCTEQSHFVRKKYHQLRGVCVHFLLSTPRNNVAR
DKYALRREWSSAKLCNRAKCSKKRQIMQVSFGKGSFQHDESTFQRGNILSNKKMKLIIRQ
LNRTKWYDFKFFSPAKVNLFLRLKERKETHNELSTLMHAINLGDDIFITALSTEEQKKLT
ELLFPCRSGDFLTIQKDEEHEGEHKNEEMTPGGKEEDTRYYYNHYPLNDDNIIAKVLRRY
REELDTRDNVKFLIHVVKRTPIFSGIGGGSSNGASLFYFLEKYYYRYLKSNQLRNEFLKT
IGSDISFFSSSGFAYCTGKGNNVIDLSDAQATISGRRIYIFQISEGLSSRTVYQNVDYGQ
IVQYNPVSLLKRFIVNGESCNAVKHVEEAERSYLKRFVPLDGTSLMNSFVNDLEHSAFAL
LKKVKCLKDLLLNRSLFDAVTMSGSGSSLFALTKKNMSLDEEKMQMKNLIKQVREKLRVP
LKVYLCSALRKKENLWYRPGQLAERVA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagatttggtttaaccgtgaaaggggtcctacttctatgtgtgcgtttgcttcataca
attgtagtctcaaaaaatgtttgcactgagcaaagccattttgtgagaaaaaagtaccac
cagttgaggggtgtgtgtgtgcatttccttctttccactccacgtaacaatgtcgctagg
gataaatatgctttgaggagggaatggtcgtctgcaaaattgtgtaatcgtgctaagtgc
agcaagaagaggcagataatgcaggtcagtttcggcaaaggcagtttccaacatgatgag
agtacattccaaaggggaaacatcctgagcaataaaaaaatgaagttaataattcgtcag
ctgaacaggaccaagtggtacgacttcaaatttttttccccagcaaaagttaatttattt
ttaagactaaaggaaagaaaggaaacccacaatgaattatcaaccctaatgcatgcgata
aatttaggcgatgatatttttataactgctttgagtacggaggagcagaagaagttaaca
gagctgctgtttccgtgccggtctggcgatttcttaaccatacagaaggatgaagagcac
gagggggagcacaaaaatgaggagatgaccccaggggggaaagaagaagacacgagatat
tattacaaccattacccactaaatgatgataacataattgcaaaggtgttgagaagatac
agagaagaactagacacacgggacaatgtcaaatttttaattcatgtggtgaagcgcact
cccatttttagtggaataggtggagggtcatctaatggagcttcccttttttatttcttg
gaaaagtattactacagatatttaaaatcaaatcagttaaggaacgaatttttaaaaact
ataggaagcgatatatccttttttagcagctccggttttgcctactgtactggcaagggc
aataatgtcatcgatttgagtgacgcccaggcaaccatctcggggcgcagaatatatatt
tttcaaatcagcgagggactctcctctaggacggtctatcaaaatgttgattatggccag
atagtgcagtataaccctgtgagtttgttgaaacggttcatagttaacggggagagttgc
aatgccgtcaagcacgtggaagaagcggagcgaagttatttgaagcggttcgtgccgctg
gacgggacatctctaatgaatagctttgtaaacgacttggaacactctgcgtttgctttg
cttaagaaggtgaaatgtttgaaggaccttctactgaatcgaagccttttcgatgccgta
acgatgagtggaagcggctcctcgttatttgcactgacaaaaaagaatatgagtttagac
gaggagaagatgcaaatgaaaaatttgattaagcaagttcgggaaaagttgcgtgtacct
ttaaaggtctatctgtgtagcgctttgcggaagaaggagaacctgtggtataggccgggc
caactcgcggagagggtggcctag

DBGET integrated database retrieval system