KEGG   Plasmodium vivax: PVX_097995Help
Entry
PVX_097995        CDS       T01073                                 

Definition
ATP-dependent RNA helicase
Orthology
K12811  
ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
pvx  Plasmodium vivax
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:pvx03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1341 aa AA seqDB search
MSDYYERYRRERNNSIASSSKRKRSDSRYDNHERKKEHHEEGSYKRARPLEDDDEEEASF
GRDMQRYRERLREQWGDRVRRERDRDKEREKYYERGHERGYERGYDRGYEREWDHERDRE
RERPKKPKRKEHHSHSSDEEDEHSDGRSDRGRHRVSGARHPGDASERRVQRERERYEAKE
SRGERRRPRKRSTSDDRSDEGSSDRRKERGDPRWKQSSERSTFEERHPKEKKKKKKKRDS
SSDGGSSTGRDSPKGRESDKRERGSNRGDKNGEAAVPAATATATTTAAADSVEGGAKPDG
ENESKLSRLERLKRFAERIKKTGSDETSPKAGVKSTKFTLSTPASSAGRKFALDVFAGGM
GGEEEEEEEEEEEEKKKKEKLKWKMNGKANGKANGKANGKANGKANGKVTGKTTGKANGK
TKKDGATRRGSHSNSPIRRNGGEEPAEEAPPEQSPAGDDKEDPLEAFMRNLERNCPGEEG
EAVGPNQTITLEEIYSYDANRHRFEGAKQRGGSPPGAADPSGEVDKAAPQADGKSPQTGG
QPPQTDGQPPQSGEEYHRLFVQALRRKAAEEREEEGHEEGDRSSGRSSAQSSGHLSEDSE
YNAETNALKKTNKKLLQVNRDQVEYLPIKKNIYVQVSEITNMKESDVDLFRKNNGNIIVR
GKNCPRPVQYFYQCGLPSKILPILERKQFKKMFGIQMQTIPALMCGRDVIAIAETGSGKT
LSYLFPLIRHVLHQPPLRNNDGPIAIILTPTRELSKQVKSEARPYCQAVNLRILAVYGGS
NIGTQLNTLKRGVEILVGTPGRIIDILTISNCKVTNLNRVSFVVLDEADRLLDLGFESQI
HNILNNCRKDKQTAMISATFPNYIQNLAKKLLYKPIEIIVGEKGKTNNNIYQFVEVLEGG
KKIYRLLKLLGEWSSYGLILIFVNRQLEADLLYLELFKYDYKTLVLHGGQDQADREFTLQ
TFKEGKNKILIATSVMARGIDIKDIIVVINYECPDHLEDYIHRVGRTGRSNKIGYAYTFV
SPEEHAKAYDIYSLIKNNIYYMNKTIDMPRELEELVREFTQSSNYAEVRKKGYKGKGFKF
TPNEKSRLQMDKANAKRELGLPNPQNEIKRIELEIQRIKMNDTMDLSLKAKQINELMKTY
NFVAHQQKSLKKSADAAQEADIEKMAEQEATKATEHIKDEAERQQLFNKVKQEVKKKLMD
SKLQSNSRTENIHRNMLLNSMRTRNMKKYSPYIPNTYITEDNCILQEFYINDYPQHVRLK
ICNREVLSRVAEMSGSRCQIKGQYSNPTQPNKTTFLLDAKPLHIEISASNYNQVQIAHNE
FTSLISQLLQNSGMKGHRKGG
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactactacgagcgctacagaagggagaggaacaacagcatcgccagtagcagc
aagcggaagagaagcgacagtcggtatgataaccatgaaaggaagaaggagcaccacgag
gagggctcctacaaaagggccaggccgctggaggacgacgacgaggaggaagcgagcttt
ggcagggatatgcagcgctatagggagcgcctgcgggagcagtggggcgaccgggtgcgg
cgcgagagggatcgagacaaggagcgtgagaaatattacgaaagaggacacgaacggggt
tacgaacggggatacgatcgaggttacgagcgggagtgggaccatgagcgggaccgggag
cgggagcgccccaagaaacccaagaggaaggaacaccactcccacagcagcgacgaagaa
gacgaacactcggacggcaggagtgacagaggcaggcaccgagtgagcggcgcgaggcac
ccaggagacgcctccgaaaggagggtgcagcgcgagagggaaagatacgaagcgaaggag
agtcgcggggaaaggaggcggccaaggaaacgcagcaccagtgatgacaggagcgacgag
ggaagtagtgacagaaggaaggaacggggagacccccgctggaagcaatcctcggagagg
agcacttttgaggaaaggcaccctaaggagaagaagaaaaagaaaaaaaaaagagactcc
tcttcagacgggggaagcagcaccgggagggattcgcccaaggggagggaaagtgataaa
agggaaaggggaagcaataggggagacaaaaatggagaagcggccgtccctgccgcgacc
gctaccgctaccactaccgctgcggctgactccgtagaagggggggcgaagccagacggc
gaaaacgagagcaagctctccaggctggagcgactcaagcggttcgcggagaggatcaaa
aagacgggcagtgatgagacgagccctaaggccggtgtgaagagcaccaagtttacgctt
agcacgccggccagcagcgccggaaggaagttcgccctggacgtgtttgcgggaggcatg
gggggggaagaagaagaagaagaggaggaggaggaggaggagaagaagaagaaggagaag
ttgaagtggaagatgaatgggaaggcgaatgggaaggcgaatgggaaggcgaatgggaag
gcgaatgggaaggcgaatgggaaggtgacgggcaagacgacggggaaggcgaatggaaag
acgaagaaggatggtgccacccgtcgaggctcgcattccaattcgcccatcaggagaaac
ggcggagaggagcccgcagaggaagctccccctgagcaatcccccgcgggggacgataag
gaggaccccctcgaggcgttcatgcgaaacctggagcggaactgcccgggggaagagggc
gaggcggtgggccccaaccagaccataacgctggaggagatttacagctacgacgcgaac
cggcaccggttcgagggggccaagcagcgggggggctctccccccggcgcggccgacccc
tcgggggaggtcgataaagcggcgccccaggcggatgggaagtctcctcaaacgggtggg
cagcctccccaaacggatgggcagccaccccagagcggcgaggagtaccaccgactgttc
gtgcaagcgctgaggaggaaggccgcggaggagagagaggaggaaggccacgaagaaggc
gatcgaagcagcgggcgaagcagcgcgcagagcagcgggcacctgagcgaggacagcgag
tacaacgcggagacgaacgcactcaagaagacgaacaagaagctgctgcaggtgaaccga
gaccaagtggagtacctgccgataaagaaaaacatctacgtgcaggtgagcgagataacg
aatatgaaggagagtgacgtggacctctttaggaagaacaacggaaatataatcgtgagg
gggaagaactgcccccgaccagtacagtacttctatcagtgcggactgccttcaaaaatt
ctgcccattttggagaggaagcaatttaagaaaatgtttggcattcagatgcagacgatc
cccgcgctgatgtgtgggagggatgtaatcgccattgccgaaacggggagcgggaagacc
ctatcctatttgttcccactcattagacacgtccttcaccagccacccctccgaaataat
gatggcccaatcgccatcatcctcacgccaactagggaattaagcaaacaagtgaagagc
gaagcgaggccctactgtcaagcggtgaatctcagaatcttggccgtctatggaggttca
aatataggtacacaactgaacacattaaagagaggagtagaaatattggttggtacccca
ggacgtataatcgacatactaacgatcagcaattgcaaggtgacgaacctcaatagagtc
tccttcgtcgttttggatgaagcagatcggttactagatctaggctttgagtcccaaata
cataacatccttaataactgcaggaaggataagcagacggccatgatttcggccaccttc
cccaattacattcaaaacctagccaagaagttgctttacaagcccatagaaatcattgtg
ggggagaaaggcaaaacgaataataatatttaccaatttgtggaagtcctagaggggggg
aaaaagatctatagacttctgaagctccttggagagtggtcctcctacggattgatcctc
atttttgtgaacaggcagttggaagcggacctcctatacctagaactgttcaaatacgat
tacaaaacgttggttttgcatggagggcaggatcaagccgatagggaattcactctgcaa
acttttaaagaggggaagaacaagatactcattgccacctcggtcatggctagaggaatc
gacataaaggacatcatcgtcgtgattaactatgagtgtccagatcatctggaagattac
attcatcgtgttggaaggacgggaagatcaaacaaaattgggtatgcgtatacgtttgtc
tcccctgaggaacacgcaaaagcgtatgacatctacagcctcattaagaataacatttat
tatatgaacaagacgattgacatgccgagggagctggaggaactcgttcgcgaattcacc
cagagcagcaactacgcggaggttaggaagaagggctacaagggcaaggggttcaagttc
actccgaatgagaagtcccgcctgcagatggataaggcaaacgcgaagagggagctcggc
ttgcccaacccgcaaaacgaaatcaaacgaatcgaactcgaaatacagaggatcaaaatg
aatgacaccatggacctctccctaaaggcgaagcagataaacgagctcatgaagacatac
aacttcgtggcgcaccagcagaagagcctcaaaaaaagtgcagacgctgcccaggaagct
gatattgagaaaatggccgagcaggaggccaccaaggcgaccgagcatataaaggatgaa
gcggaaaggcagcaactctttaacaaagttaagcaggaggtgaagaaaaaactaatggat
agcaaactgcagagcaactctagaacagaaaacatccatcggaatatgcttcttaactcg
atgaggactcggaacatgaagaagtactctccttacattcctaacacgtatattacggag
gacaactgcattttacaggaattctatattaatgactatccgcagcatgtgcgtctgaag
atatgcaaccgggaggtgctctcgcgcgttgcggaaatgtctggctcgaggtgccagatt
aagggccagtactccaaccccacgcagccaaacaagaccaccttcctgctcgacgccaag
ccgctgcacatcgaaatatctgcgtccaactacaaccaggtgcagattgcccacaacgag
ttcacgtccctcatcagccagctgctgcagaacagcggcatgaagggccaccgcaagggg
ggatga

DBGET integrated database retrieval system