KEGG   Plasmodium vivax: PVX_098085Help
Entry
PVX_098085        CDS       T01073                                 

Definition
topoisomerase I
Orthology
K03163  
DNA topoisomerase I [EC:5.99.1.2]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     PVX_098085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 931 aa AA seqDB search
MERSEHPDKGDNVTSDDDILIENIKKKNCCIKLNDSKQISEGKKEETKAKKIVKSNSKTV
LKKETSTVIRKTKSKTSAKESKEAPLNECKVVKKGKAAANAGDAAKENPTTSNNKTEKKN
AVVKKRKSSVKEKKDTDGKPTAAKVVKKRESKVKKETNKRPKKVVKKTEENFEPINRWWE
KIDHQTDVQWHYLEHRGLIFSPPYVQHNIPIFYKSIKLQLNEKAEELATYWCSVIGSDYC
TKEKFILNFFRTFICTLEKDNIIRQENESKLKKGDISNFKFIDFMPIKDHLVKLREEKLN
RTKEEKEEEKKLRSEKELPYTYALVDWIREKISSNKAEPPGLFRGRGEHPKQGLLKKRIF
PEDVVINISKDAPVPRLYDDMCGHCWGDTYHDNKVTWLAYYKDSINDQLKYTFLSAQSKF
KGYKDFLKYENARKLKSCVHKIREDYRHKMRNKSILDKQLGTAVYLIDFLALRVGGEKDI
DEEADTVGCCSLRVEHVSFSHEVPIKNESRGERSKGERSKGERSKGEKSKGEKSKVKNGS
EETANGEPPNEGTTPNESDHKGSGKLPLPKNLDDIEEDHCYLTFDFLGKDSIRYFNTVKL
DKQAYINMIIFCKKKHKDEGVFDQINCSKLNDYLKEIMPTLSAKVFRTYNASITLDQQLK
RIKEIRGKPTDPLLSCYDDLPKRKKRKLGNATSSTSILSDTSDSTQNEPSGDGEEGEKKK
QDDGDTAPGDTAPPPSRSNTNALGGIHASEKNSPIEVDVSNVNELINFFNNANREVAILC
NHQRSVPKQHDSAMSKIKKQIEIYSEDIKEYKKYLQYLKKGMNEQSFTFVSKVVALDGSL
RPNKVKENMKEESCKKKLIALIKKVEQLKHQMKVRDDNKTIALGTSKINYMDPRITVAFC
KRFEIPIEKIFNRSLRLKFPWAMFVTKNFTF
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagcgaacaccccgataagggcgataacgtcacatccgatgacgacatattg
attgaaaatattaagaaaaaaaactgctgcatcaaattaaacgactcgaaacaaataagt
gaaggtaagaaggaggagacgaaagcgaagaagattgtgaagagcaatagtaagacagtt
ttgaagaaagagacgagcaccgttattcgaaagaccaagtcgaaaacgagtgcgaaggaa
agcaaagaagctcctctaaacgaatgtaaagtggtgaaaaagggtaaggcagctgccaac
gcaggggatgcagctaaggaaaaccccactactagcaacaacaagacagaaaaaaaaaac
gcggtggtgaaaaaaagaaaatcaagtgtaaaggaaaaaaaagacacggatgggaagccc
acagctgccaaagtggtaaaaaagagagaaagtaaagtcaagaaagaaacaaataaaaga
cccaaaaaggtagttaaaaaaacagaagaaaatttcgaacccataaatagatggtgggag
aagatcgatcatcaaacggatgttcagtggcattacttagagcatcggggtcttattttt
tcccccccctatgtgcaacacaatattcccattttttacaaaagcatcaaattacagtta
aatgaaaaagcagaggagttagctacctactggtgcagcgtaataggcagtgactactgt
accaaggagaagttcatattaaattttttcagaaccttcatatgtaccctagaaaaggat
aacataataagacaagaaaatgaaagcaaattgaaaaaaggagacatatctaattttaaa
tttatcgattttatgccaatcaaagatcacctagttaagctaagagaagaaaaacttaat
agaacgaaagaagaaaaagaagaggaaaaaaaattgaggtcagaaaaagaactaccatat
acatacgccctggttgactggattcgggaaaaaatttcgagcaacaaagcggagccgcct
ggtctatttagaggcagaggagaacaccccaaacaggggttgctaaaaaaaagaatattc
ccagaagatgtcgtaataaatataagcaaagacgcccctgtccctcgattgtacgacgac
atgtgtggccactgctggggagatacctaccatgacaataaggtaacgtggctagcatac
tacaaggacagcataaacgatcagttaaaatatacgtttttatctgcccaatccaaattt
aagggctataaagattttctgaaatacgaaaatgcgaggaagctaaaatcatgtgttcat
aaaattagggaagattataggcacaaaatgaggaacaaaagcatcctggacaagcagcta
ggcaccgccgtttatttgatagactttttggccttaagagtcgggggggagaaagacata
gatgaggaggccgacacggtgggctgctgcagtttgagggtggagcacgtgagcttttcc
cacgaggtgcccattaagaacgagagcaggggggagaggagcaagggggagagaagcaag
ggggagaggagcaaaggggagaagagcaaaggggagaagagcaaggtcaaaaacggcagt
gaagaaaccgccaacggggaaccccccaatgaaggaaccaccccaaacgaaagtgaccac
aaaggcagcggcaaactcccgctgccgaaaaatttagacgacatagaggaagaccactgc
tacttaacttttgactttctaggaaaagacagcattcggtattttaacacggtgaagcta
gacaagcaagcatacatcaacatgatcatattttgcaagaagaagcacaaagatgagggg
gtgtttgatcaaattaactgctcaaagctaaatgattatttgaaggaaattatgccgacg
ctgtcggccaaggtgttccgtacgtacaacgcgtcaattaccctagatcagcagctgaaa
aggataaaagaaattcggggcaaaccgacggacccgctgctctcttgctacgatgatttg
cccaagaggaaaaagaggaagctcgggaacgccacttcgtcgacgagtattctaagcgat
acgagtgactccacgcaaaatgagccaagcggggatggcgaggagggggagaaaaagaag
caggacgatggcgacaccgcaccgggtgacactgcaccccccccgagcagaagcaacacc
aacgcgttgggaggcatccacgccagcgagaagaactcgcccatagaagtggacgtttca
aatgtgaacgaactcatcaacttcttcaacaacgctaatagagaagttgccattctgtgt
aaccaccagaggagtgtccccaagcagcacgactcagccatgtcaaaaataaagaagcaa
atagaaatctacagcgaagatataaaggagtataaaaaatacctgcagtacctgaaaaag
gggatgaacgagcaaagcttcacctttgtgtcgaaggttgttgccttagatgggtcgtta
agacccaacaaggtgaaggaaaacatgaaggaggagtcctgcaagaagaagctaattgcg
ctcatcaagaaagtggagcagctaaagcaccaaatgaaggtacgcgatgacaacaagaca
attgccctggggacgtctaaaattaattatatggaccccagaataaccgtcgccttctgc
aagaggtttgaaattccgatcgagaaaatatttaataggagcttgaggcttaaatttccc
tgggcgatgttcgtgacgaagaattttaccttttag

DBGET integrated database retrieval system