KEGG   Plasmodium vivax: PVX_098770Help
Entry
PVX_098770        CDS       T01073                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pvx  Plasmodium vivax
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PVX_098770
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PVX_098770
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PVX_098770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 437 aa AA seqDB search
MIECIENYIKTFKEKENLYVKKKVSIIGSPLSAGQPLGGVHLACDNLRMLGLHKVIEALG
WSYEDVGNVGAAGSVGSGGSTDSGGSIGSDEGTDSGGSDIDKDIGGRRTYEQAEMNGRLN
THNSSSAHTEKYHHGMEKLNGDTKLNHCCNGKDNANWENHSNRNDHRGERCMTNKCVQNN
YYDNIKNVEIIGKFSEKLFRKMSNELRKKNFVLNIGGDHSVAFPSILSSLQFYRDLRVIW
IDAHGDINIPETSPSGNYHGMALAHTIGLFKNKVPCFEWSEKLTYLKPENVAIIGIRDID
IYEKIILKKCNINYYTIFDIEKNGIYNTICTALNLLDPHENCPIHISLDIDSVDSFFAPG
TGTIAKGGLNYREINLLMKVLADTRRVVSMDLVEYNPSLDENDKKVHSDSLPISEYATKT
GRLCLELIARVLGNDIV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatgcatcgagaattacataaaaacgtttaaggagaaggaaaacctgtatgtg
aaaaaaaaagtgtccatcattgggtcccccctgtcggctggacagcccttgggaggggtg
cacctggcatgtgacaatttgaggatgctcggtctgcacaaggtgatagaggccttgggc
tggagttacgaagacgtaggaaatgttggcgctgctggaagtgttggcagcgggggaagt
accgacagtggtggaagtattggtagcgatgaaggtactgacagcggtggaagtgatata
gacaaagatatcggcgggaggaggacctacgaacaggccgaaatgaacggaaggctaaac
acgcacaacagcagctctgcacacacggagaagtaccatcacggaatggaaaaacttaac
ggagatacaaaattaaaccactgctgcaatggcaaagataatgccaattgggaaaatcat
agcaacaggaatgatcacaggggagaaagatgcatgacgaataaatgcgtacaaaataac
tactatgataatataaaaaatgttgaaattattggaaaatttagtgaaaaattatttcgc
aaaatgagtaacgaattgaggaagaaaaattttgtattaaacattggaggtgaccacagt
gtggcatttcctagcatcctgagctctttgcaattttacagagatttaagagtcatatgg
atagatgcccatggagacattaacatcccggagacctctccctcaggaaattatcatggc
atggcattagctcacaccatagggctctttaaaaacaaagtgccatgcttcgagtggtct
gaaaagctcacttatttaaaaccagaaaatgtggccatcattggaataagagacatcgat
atatatgaaaaaattattttaaaaaaatgcaacattaattattatacaatctttgacatt
gaaaaaaatggcatatacaataccatctgtacagcccttaacctgctagatccccatgaa
aattgccccatacacatttctctcgacattgatagtgtcgatagctttttcgctccagga
accggaaccattgccaagggcggcctaaattacagagaaattaatttactaatgaaagtc
ctggcagacacaaggcgcgtcgtttcaatggatttggtcgagtataacccatctctcgac
gaaaatgacaaaaaggttcacagcgattccttgcccatttcggagtatgccacgaaaacg
ggcaggctttgtctggagcttattgccagggtcctcggcaacgacatcgtctag

DBGET integrated database retrieval system