KEGG   Plasmodium vivax: PVX_099055Help
Entry
PVX_099055        CDS       T01073                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pvx  Plasmodium vivax
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVX_099055
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PVX_099055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 445 aa AA seqDB search
MKSCVTLLFLFCACVKYVSCQADQIINEKLTKLVFLSCNYQKGKPNETLIKSVEKKKPQL
MLWVGDYFYSECKELKCLHEVYDYIKKDPFYIGLKKKFVIDGIYDDHDYNKNNGDKLYEH
KKESKTQYLNYLNVPKNDFRYKRNGAYISKLYVDPENEKNQVKIIILDTRYNKDPYPFYA
PDSYHDSLMHIFVSFVVRFHAALFGLHCDSKNDILGNEQWTWLEKELTNSSARAHIVISS
MQIFSNHIVNENWGLMPFAQKRLKHLMNKTKPKGLLFLSGDVHFGSIIGNEENVLEVTSS
SVNQENIFSYINKYFVYFSTNLLNKKSPFDLNNIFSYNNFGSLSISYVNDDEIKIKSAIH
DSDGNEIIVANQTFNKKKNVYQKTQNLHLLHDDIATFTCKSNAKVGIHVVIYVLFVLWFL
QIIFIFCKLLGFCKQKKVADKTKGE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttgcgtaactttactttttctgttctgcgcatgtgtcaagtatgtgagttgc
caagcggaccaaataattaacgaaaaattgaccaagctggtttttttgagctgtaattac
caaaaggggaagccaaatgagacgctaataaaatcggtggagaagaagaagccacaactt
atgctctgggttggagattatttttactcagaatgtaaagaattgaaatgcctgcatgaa
gtgtatgattatattaagaaggatcccttctacatagggttaaaaaaaaagtttgtaata
gatggcatatatgatgatcacgattataataaaaataatggagataaactgtatgaacac
aagaaggaaagcaaaacgcagtacttaaactatctgaatgtgccaaaaaatgacttcagg
tacaaacggaatggtgcatacatttcgaaattgtatgtagacccggaaaatgaaaagaat
caagtgaagatcatcattttagacaccagatataacaaagacccgtaccccttttatgcg
cctgactcataccatgacagtttgatgcatatattcgtttcgttcgttgttcgctttcac
gccgccctgttcggtttgcactgcgacagcaagaatgacattttgggcaatgagcagtgg
acgtggttggagaaggagctcaccaactcgagtgcgcgcgcgcacattgtcatttcgtcc
atgcagattttctccaaccatatagtaaacgagaactggggattaatgccattcgcccaa
aagcgactaaaacatttgatgaataaaaccaagccgaaggggctactcttcctaagcggt
gatgtgcactttggcagcataattggaaacgaagaaaatgtgctggaagtcacaagcagc
agtgtaaaccaggagaacatatttagctacatcaacaagtatttcgtttatttctccacc
aacttgctgaacaagaagagtcccttcgatttaaacaacatattttcatataacaatttt
ggctcacttagcatatcatacgtaaacgacgacgaaataaaaataaaatccgcaattcat
gactcggatggtaacgaaattatagtggccaaccaaacgtttaataaaaaaaaaaacgtc
tatcagaaaacgcagaacttgcatttattgcatgatgacatagcgacgttcacgtgtaag
agcaatgcaaaggtgggtatacacgtcgtaatttacgtactgtttgtgttgtggtttttg
caaattattttcatcttttgtaagctgctcggattttgtaagcaaaagaaggtcgcagac
aagacgaagggggagtaa

DBGET integrated database retrieval system