KEGG   Plasmodium vivax: PVX_099700Help
Entry
PVX_099700        CDS       T01073                                 

Definition
(RefSeq) histone deacetylase
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PVX_099700
Chromosome [BR:pvx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PVX_099700
   HDAC complexes
    Sin3A-HDAC complex
     PVX_099700
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PVX_099700
  Chromatin remodeling factors
   NuRD complex
    PVX_099700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 448 aa AA seqDB search
MSNRKKVAYFHDPDIGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNEL
TLFHDYEYVDFLSSISMENYREFTYQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAA
KLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILELLKYHARVMYIDIDVHHGDG
VEEAFYVTHRVMTVSFHKFGDYFPGTGDITDIGVHHGKYYSVNVPLNDGITDDAFVDLFK
VVIDKCVQTYKPGAIILQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNLPLLVLGGGG
YTIRNVSRCWAYETGVVLNKHHEMPDQISLNDYYDYYAPDFQLHLQPSSIPNYNSPEHLS
RIKMKITENLRNIEHAPGVQFAYVPPDFFDSEIDDECEKNQYELKDDGGGGRAAGTRAKD
HATSHHLRRKNYEDDFFDLSDRDQNVAL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccgcaagaaggtggcctacttccacgaccccgacatcgggagctactactac
ggggcggggcacccgatgaagccgcagagaatccgcatgacgcactcgctgatagtctcg
tacaacctgtataagtacatggaggtgtaccggccccacaaaagtgacgtaaacgaactg
accctcttccacgactacgaatatgtagatttcctctcctccatttcgatggaaaattat
cgtgagtttacataccaactgaagcgattcaatgttggggaagcaaccgactgtcctgtg
ttcgatggcctcttccaattccagcagtcatgtgcaggtgcttctatagatggggcagcc
aagctgaatcaccactgtgcggatatctgcgtgaactggtcaggcggattgcaccacgcg
aagatgtccgaggccagtggcttctgctacatcaacgatatagtactaggaattttagaa
ttgctaaagtaccacgcgagggtaatgtacatagatattgatgtgcatcatggggatgga
gtggaagaagctttttatgtaacccatcgagttatgactgtctcatttcacaaattcggg
gactattttccaggaactggcgatattacagacattggggtgcaccacgggaagtactac
agtgtgaatgtgcccctaaacgatggaataactgatgatgcgtttgtggacctctttaaa
gtagtgattgataagtgcgttcaaacgtacaagccgggggcaatcatactgcaatgcggg
gcggacagtttaacgggggaccgattaggaagattcaatttaaccattaagggtcatgcc
agatgtgtagaacacgttcgctcgtataatttaccccttctcgttttaggtgggggagga
tacaccattagaaatgtctctcggtgttgggcctacgaaacgggagttgtgctcaacaag
catcatgaaatgcctgaccagattagcctaaacgattattacgattattatgcccccgac
tttcagctgcatctacagccttcaagcatccccaattataactccccagaacacttgagc
agaatcaaaatgaaaattacagaaaatttgaggaacatagaacatgcccctggcgtccag
tttgcctacgtccctccggatttctttgactccgaaattgatgacgagtgcgaaaagaac
caatatgagttgaaagacgacggggggggcggccgcgccgcaggcaccagggccaaggac
cacgccacctcccaccacctgcgcaggaagaactacgaggacgacttcttcgacctctcc
gaccgggaccagaacgtcgccctctga

DBGET integrated database retrieval system