KEGG   Plasmodium vivax: PVX_099895Help
Entry
PVX_099895        CDS       T01073                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pvx  Plasmodium vivax
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pvx00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 196 aa AA seqDB search
MARIPPLVVCGPSGVGKGTLIKKVLSEFPSRFRFSISCTTRNKREKETNGVDYYFVDKDD
FERKLKEGQFLEFDKYANNFYGTLKSEYDLAVGEGKICLFEMNINGVKQLKESKHIQDGI
YIFVKPPSIDILLGRLKNRNTEKPEEINKRMQELTREMDEADKVGFNYFIVNDDLARTYA
ELREYLLGSYPQLRGG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaatcccgccgctggtcgtgtgcgggccctcgggcgtggggaaggggacgctg
ataaagaaggtgctgagcgagttccccagccgcttccgcttctccatcagctgcacgacg
cggaacaaaagggaaaaggaaaccaacggggtggactactacttcgtagataaagacgac
tttgagcgaaagctaaaggaaggacagttcctagaatttgacaaatacgcgaataatttt
tatgggactctaaaaagcgaatatgaccttgccgtgggggaggggaaaatctgcctgttc
gaaatgaacattaatggagttaaacagttaaaggaatccaagcacatacaggatggcata
tacatttttgtaaaaccaccgagcattgacattcttttggggagactaaagaataggaac
accgaaaagcccgaggagattaacaagcgcatgcaggaattgacgcgcgagatggacgag
gccgacaaggtgggcttcaactacttcatcgtgaacgacgatttggcgcgcacctatgcg
gagctgcgcgagtacttgctgggctcctacccgcagctgcggggggggtag

DBGET integrated database retrieval system