KEGG   Plasmodium vivax: PVX_100950Help
Entry
PVX_100950        CDS       T01073                                 

Definition
3-hydroxyisobutyryl-coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pvx  Plasmodium vivax
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pvx01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pvx00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pvx00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pvx00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 516 aa AA seqDB search
MQKLGSRLHLGEAKCGRRGFQHYVVKPERGGSLFCARHFFAREANPQSELNGAPFCERRQ
VSGFFTKARNNCSVDGKGRNEILFEKMEKKDSNILHMTKQSVSSEKAATVDSAKGGSGEG
EPLLKHGDEDKVASRKGENQSREPLPPVIDLELSEVWSKKTLILNFKNSVFEIILNRPEK
LNAINKDMINGLLNIVKSLNSDDRCHLIIIKSSNTTCFCSGSDVKDIVQNKEKGMQHLKQ
LYMYIHYLSKMKKPVLCIWNGYAMGGGLGISMYAKFRVINKKAIFAMPENKIGFFPDISC
SYFFKKYFGRNIGLHLGLTSLRLNEADLVNFKICSNYVEDVGGLLNEIYNIGRPNQKEFE
RELSTILGKYPPKVTTETKPVLTHELISNIDRYYSVAANLNDLLSKLKKDQRNPFCQQTL
EAINQNCLSSCNLWFEYFLYNYDKPLEEVLDNDFKITQHFLYHTDTFEKGVTELLVKKNK
SFKWSSARESGDLHAGPSVEDILTNSGLLSIRGELT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaggctcgcgactccatctgggagaggccaagtgcggaagacggggcttt
cagcattatgtagtcaagcctgagaggggcggctctcttttttgtgcgcgccattttttt
gccagagaagccaacccgcagagtgagttgaacggcgctcccttctgcgaaaggagacaa
gtcagcggcttcttcaccaaagcgaggaacaactgctccgtcgatggaaaaggaagaaat
gaaatactttttgaaaaaatggaaaaaaaagatagcaatatactccatatgacgaagcag
agcgtgtccagtgagaaagcagccacagtcgattctgcgaaagggggaagcggggaagga
gagccacttctaaaacatggggatgaagacaaagtggccagtcgaaagggggagaaccaa
agtagggaacccctccccccagtcatagacctagaactgtccgaagtgtggtccaaaaaa
acgctcattctaaatttcaaaaatagcgtattcgaaataattttaaacaggccagaaaag
ctaaacgcaattaacaaagatatgattaacgggttgctaaacattgtgaagagcctaaac
agcgatgataggtgtcacctgatcatcataaaaagtagcaacacgacgtgcttctgctcc
ggttccgatgtcaaggacattgtccaaaataaagaaaaagggatgcagcatttgaagcag
ctctacatgtacattcactacttatccaaaatgaaaaaacctgtcttgtgcatatggaat
ggttatgctatgggaggaggtttagggatttccatgtatgcaaaatttagggtaataaat
aagaaggccatatttgccatgcctgaaaataagattggcttcttcccagatatcagttgc
tcctacttttttaaaaaatatttcggaaggaacattgggctgcatctagggttgacatcc
ctacgattaaacgaagcagatttagtcaactttaaaatttgcagcaattacgttgaagat
gtgggtggactgctcaacgagatttacaacattgggaggccaaaccagaaggagttcgag
agggaactctccaccattttaggcaagtaccccccgaaggtcactacagagacgaagccg
gtacttacccacgagctgattagcaacattgataggtactacagtgtggccgctaaccta
aacgatcttcttagcaagttgaagaaggaccagcgcaaccccttttgccaacaaacgcta
gaagctataaaccagaactgcctctccagctgcaacttatggtttgagtatttcctttac
aattacgataagcccctggaggaggtgctggacaacgattttaaaattacgcagcatttt
ttgtaccacacagatactttcgagaagggcgtaacggaactgctcgtgaagaaaaataaa
tccttcaagtggagctccgcgcgggaaagtggcgatctgcacgcgggtccaagcgttgaa
gatattctgacgaacagcgggttgctgtccattcggggggagctcacatga

DBGET integrated database retrieval system