KEGG   Plasmodium vivax: PVX_101110Help
Entry
PVX_101110        CDS       T01073                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pvx  Plasmodium vivax
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PVX_101110
  Replication and repair
   03420 Nucleotide excision repair
    PVX_101110
Transcription machinery [BR:pvx03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PVX_101110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 960 aa AA seqDB search
MVRTRKNIENMEIYDYMKEMSEKIWTYLFEDSLAHEAILHSLNELEQIIISRLLFIQQVV
SERAMRLWINPNSLKKLSECIKNLVEAKILVESETKKDNYNQYKINEKFRHTMLNKIYKN
REDKIFIFNNNVKEQMEKEKNLHENNLYPTKEEVANYAHMRWNNLLHFIASPKLSHLNSY
MVYTNGISVEHRQEVYPPQTGLPVSRNDDKGDPNRNKNVDKGATSFNTPSKKGRKKSQAD
DEEYRPYGHSLYGGAAHNVVNYPAVKEEENEEEENEENDEGEDDDGEADEEDDEGDNSDN
EDHPAEGAKYEKGPNEDAKYDQYGYHLEQGESAGAPPIGSAHKLHTHEANQYYTHHSGRK
KKKKKKKKKKGVYAYKQNDLYYRSLQNVENGYPNGYPNGYSNGYPNGYPSGFPNGCPNGF
PEEDNNDNSFFYSNAKKDACPSYTPCDSLIEVLKRKNFILQDDANSNKAVNMSREAFSWF
LKDIRSRIISLVLEYLLIIDDGYVTNVAREISTKYKKKKNSSADAGIGGGSSANGPSAES
GYAGYTAYPEHGGSDNVYSDQISATHQEKPKNDGSAPPCYVTEEKKDQKKSELYVRETLL
LILSISQCTISHPIYLDNLTKAQKEFINFGIHIGLFLKRTEDYVFVTPYALLLTINNLNV
QNYVAVMNSLTVEGLSENAYNEYIAIGEDGVDNNLPSKSSNVVPSRSVDIARHGHTDGGE
KKISEKYFHHYSLLQEEKKRPPKRGSHQDMDKMKITHELASQHLSPEKKMNGSNILEMGL
IVQSNFKVYLYTNSTLKINILSHLCELQARTPNMVVGILTRRSVLNAYNSDITANQIIKF
LESYAHPGRSTFKSSIPVNVITQLKLWESERHRLTLDDAIVFKSFEKEFLPHLYQQIVVW
ANSKNYLLHYTPWPKNANSPEFDAWMKSEKYLCCIYESKNEIIDKIKEIREKLMKKRQGA
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggacgcggaaaaacatcgaaaatatggaaatttatgactacatgaaggaaatg
agtgaaaagatatggacctacctgttcgaagactcccttgcccatgaggccatattacat
tccctaaatgagttggaacaaattatcatctcgcgcctcttgttcatacagcaggtggtg
tccgagagagcaatgcgcctgtggataaacccaaactctctaaaaaaattaagtgaatgt
ataaaaaatttagtggaagcaaaaatactcgtagaaagcgaaaccaaaaaggataactac
aatcagtataaaataaatgaaaaatttagacataccatgctgaacaagatttataaaaat
agggaggataaaatcttcatctttaataataatgttaaggaacaaatggaaaaagaaaaa
aatctgcacgagaataatttatatcccacgaaggaagaagttgctaattatgcacacatg
aggtggaataatctgctccattttattgcctcccccaagttaagtcacctgaacagttac
atggtttacactaatggcatatctgtggagcacagacaggaggtctaccccccacagact
ggcttgccagtcagccgaaatgacgataagggtgatccgaataggaataaaaatgtagac
aaaggcgctacttcttttaataccccctcgaagaaaggaaggaaaaagagtcaggcggac
gatgaggagtaccgcccctatggacactccctgtacgggggagccgcccacaatgtggtg
aattaccccgcggtgaaggaggaggagaacgaggaggaggaaaatgaagaaaatgacgag
ggggaggatgacgacggggaggcggacgaggaggacgatgagggggacaactccgacaat
gaggaccacccggcggagggggcaaaatacgagaaaggcccaaacgaagacgccaagtat
gaccagtacgggtaccacctcgagcagggcgaatctgcgggagcccccccgattggaagc
gcacacaagctgcatacccatgaggcgaatcagtattatacccatcatagtgggaggaag
aagaaaaaaaagaagaagaagaagaaaaagggagtctatgcgtacaagcagaatgatctg
tactataggagtctgcagaatgtggaaaatggctacccaaatggttatccaaatggctac
tcaaatggctacccaaatggctacccaagtggcttcccaaatggctgcccaaatggcttc
ccagaggaagacaacaatgacaactcgtttttctactcaaatgcaaagaaggacgcctgc
ccgtcgtacaccccgtgcgatagcctaatcgaggtgctcaagagaaaaaacttcatactg
caagatgatgcgaatagcaacaaggcggtgaacatgagtcgggaggccttctcctggttc
ctgaaggatataagaagcaggatcatttccctggtgctcgaatatttgctcatcatagac
gacggctacgtcacaaacgttgcccgggaaatttccaccaagtataagaagaagaagaat
agcagcgcggacgctggtatcggcgggggaagttctgcgaatggcccgagtgcagaaagc
ggctacgctggttataccgcttaccccgagcatggcggaagcgacaacgtttacagtgac
caaatttcggcaacccatcaggagaagcctaaaaatgatggaagtgcacccccctgctac
gtgacggaagaaaagaaggaccagaagaaatcagaactgtatgtgagggaaaccctactg
ctgattctgtccatcagtcagtgcaccattagccaccccatatacctcgacaatttgacc
aaagcgcagaaggaatttataaattttggcatccacattggtctctttttaaagcgcacc
gaggactacgtgtttgtaactccctacgcgttgcttctaacgatcaataatttgaatgtg
cagaattacgtagctgtgatgaacagcctgacggttgaggggttgtccgaaaatgcctac
aacgagtatatcgcgattggagaggatggagtggataataatctccccagcaagagcagc
aacgttgtaccctcacgcagtgtagacatagccagacatggccacaccgatgggggggag
aagaagataagcgaaaagtactttcaccactactcccttttacaagaggaaaagaaaaga
ccacccaaaaggggctcccatcaagatatggacaaaatgaagataacacacgaattagct
agccagcatttatccccagaaaaaaaaatgaatggaagcaatatcctcgaaatggggcta
attgtgcaaagcaactttaaagtatacctctataccaactcgacgctgaagataaatatt
ttaagtcatttgtgcgaactacaagcaaggacccccaacatggtcgtaggaattttaacc
aggaggagtgtcctaaatgcgtacaactcagatatcactgcaaatcagattatcaaattt
ttggaatcctatgctcacccaggtagaagcacttttaaaagctccatacctgtgaatgtg
atcacacaactgaagctgtgggagtcggagagacataggttaaccctcgacgatgccatc
gtctttaagtccttcgaaaaggaattcctcccacacctttaccagcaaatcgttgtctgg
gccaatagcaaaaattacctactgcattatacgccctggcccaaaaatgccaactccccg
gaattcgacgcatggatgaagtcggaaaagtacctctgctgcatctacgagtcgaagaat
gagatcatcgataagattaaggagattcgcgagaagctcatgaagaagcgccagggtgcg
tag

DBGET integrated database retrieval system