KEGG   Plasmodium vivax: PVX_110825Help
Entry
PVX_110825        CDS       T01073                                 

Definition
Pv-fam-d protein
Organism
pvx  Plasmodium vivax
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1896 aa AA seqDB search
MTRKRYNPKTIENYRRNYHIDDNIFVENESESLTECHMGDQTNKFFCFLVKTCTFIVLAS
TWQYTDKTHATSTYSESWASRGRLNALGVRSGRLLIGDANISIEPNYELYDDREADVLRE
NYHSSKKHLHEIFLDSNFQKRLDDSVYNNRRVRKANMKASGSGNNSINMTRESLDSLIFD
NEFNQLNEAQNDPNQLGVRLDALQHYNNFKEDIDDEQLDESFVNGYTHLEDGGRNGNNKG
FNPNYNSMMNAKESPGSSNVGKAAKSNSPRTGDNISAKRLEALNRYNNFKENCDEIQLDE
DFENNYSALQFDCRANRTLDNFKSSDNVSKNVAFEKMRGNHSSSSKQFEVPSVSDSFDES
HETIKQYSDFQDKVNDIKIDDDFKEEFYSLKRGGNGKVPFRKIKGDINRKQGFNKNNNVP
SVANFEQKYEELSNNDDSNRRSDALNYYNDFKGEVNAETLDDDFEKGYMALNPDDDANIQ
MESQGDAEGVNEIADKYPSEDNFGNMFEKYKGDNEFKKLHSSLMRSVNMDKHFDKISDDD
YGKTYNSLRPDGSTAQNLEDDQNSDDNSEDTDEEDSEKLHDALEHYNAFKEKVNDEQLDA
DFENEVTRLMENGLPPNDENLIKSDVGANRRSDKHSDTEKANQQFDQLGAVDDMNHMERF
SDDEDSTTKRFGRLNDGRRKPIHTEEYDQNEEGEQIYDEMYDQNYDANRYDGSRGEGDSN
EHYDNFRNEENPQLSLYNRFKNRRNVKNAQHEAQVSAATMEKSFEKYKNTVNEDRLDDAL
EHYNAFKEQVDGETLDDAFEKGVKRLKKQNLPKNGVHPSKGGPQSGQKRSGKMNGINNAN
SRFEGPRNNGSNHQAELDVLKSKQIDSSKLYEYSDNEQSERSKNEYDEHDDGEYGDDEYE
DENDEGEYKRYDKYKGAVHKAKMADDQRSDVTKTLKRIDDRDSDIHDRSKDGDRNGDRNG
DRNGDRNGDRNGDRNGDRNGDRNGDRNGDRNGDRNGDRNSDRKSDKNDDKNDDKDSTITG
KSKNDDKDSFISGKSKNDDKDSFISGKSKKGDNASTISGKSMDIRNKKLFHLLKKDDENY
KRQAAKLINSDNYKNKLLSAMQLTDDFKRKFNILKHSVSTEKRFDALKHYEKFKKEILNI
QLERDFMRGVNKLKPRSDTKKSLYAPKEESDDSYGSSEDKDYSDSQSDRYTNDDGDRTHY
DGASIDDRSDSQSDRLTHDGRSKKETNTKKKDNYSDRRSDISGRNNRDKKELVKKEGKYY
EDTRSIRDNHDSKSQYSVLSKKNTPKKSFAKSNNGTNYYNSKSSLVVSKDNKVVKKILVK
SKDGSVYYGSKKSLVVRKDSSADKKILDKKKDHDDYYGSKKSFVSSKVNNDVAKKSDDKP
SGTTDICETKSMYSVLSKNRSRKSLDKPRYTTIICETKSMYSVLSRNRSRKSLDKPGAPS
DHYGSKASFHSSKDKKVLKSISDKPHEESDSAKPSNALKDADSGSKRSINKINNEEKGKG
NDKDDSHSVISFHSLKDKPQDKNKSSNSLNSDEDNIDDLYDELDEAFTLNKQPKVLKQSK
EDFDKLHDDLKYDEKEFDTLYKVVESYEKIDTKKSSRSRDNDNKSVKSAHIADDDKASVK
SHEESEKDDDSLKSSYTLKRKSFTSKKSDTLKRNDKPMEINQAFRRSEQNILHPDEFRRD
RNYKDSNDKARNNRKDYNREDDYRRDNNKRDDRRRDDRRRDDRRRDDRRRNRSRRRDIDD
DYDISIENLKRKKKSILQKVLPFIGDEDEPSKLRMFNKKGLLLKIVKLIKKIDFMFEVEI
MNSMKRSLMSDAFLIKPETELNKTFYYIKKYKVLTPILITLVCLVAFYAAGLPNVAFGTV
FVLLAMIVYYNMKLTKCRKMGKLFRCFSESNKFEIR
NT seq 5691 nt NT seq  +upstreamnt  +downstreamnt
atgactaggaaaagatacaatcctaagacgattgaaaattatcgaaggaactatcatata
gatgataatatatttgttgagaatgaatcagaatctctaacggagtgccatatgggtgac
caaacaaataagttcttctgctttttggtcaagacgtgcacatttattgttttagcatca
acatggcaatatacggataagacgcatgctacctcaacctacagtgaatcatgggctagc
agagggagactaaatgcattgggtgtgaggtcgggcagactgttaattggagatgcaaat
ataagcattgagccaaattatgaactctatgatgacagagaagcagatgtgctaagggaa
aattaccattcttctaaaaaacatctgcatgaaatatttctcgatagcaattttcaaaaa
cgcttagatgattcagtatacaataatagacgtgtgagaaaggctaacatgaaagccagt
ggaagcggtaataatagcataaatatgacgagggagtcattagattcgttaattttcgat
aacgaatttaatcaattaaatgaggctcaaaatgatccaaatcagttgggagtgaggttg
gacgccttgcaacattacaataactttaaagaagatattgatgacgaacaactagatgag
agttttgtaaatggatacactcatctagaagatggtggtagaaatggtaataataaagga
tttaatccaaattataattctatgatgaatgctaaggaatcacccggttcatcaaatgtt
ggcaaggcagctaaatcaaatagcccgcgaacaggtgacaatatttctgcaaaacgattg
gaagctttaaatcgttacaataattttaaagaaaattgtgatgaaatacaactcgatgaa
gattttgaaaataattattcagcattacaatttgattgccgtgcaaacaggacacttgat
aattttaaatctagtgataatgtgagcaaaaatgtagctttcgaaaaaatgaggggtaat
catagcagctcaagtaaacaatttgaggtaccaagtgttagtgacagttttgatgaatct
cacgaaacgataaaacagtacagtgattttcaagataaagttaatgatataaaaatcgat
gatgattttaaggaagaattttactcattaaaacgaggtggtaatggaaaagtacctttt
cgtaaaattaagggtgacattaatcgaaagcaaggatttaataaaaataataatgttcct
agtgtcgctaactttgaacaaaaatatgaagaattatccaataatgatgattcgaacaga
agatccgatgcgctgaattattacaacgattttaagggagaagtgaatgcagaaacgctt
gatgatgattttgaaaagggatatatggcattaaatcctgatgatgacgcaaacatacag
atggaatcacaaggagatgcagagggagttaatgaaatagctgataaatacccaagtgaa
gataattttggaaatatgtttgaaaaatataagggagataacgagtttaagaagttacac
agttcgttaatgcgaagtgttaacatggacaagcattttgataaaataagtgatgatgat
tatggcaaaacatataattcattaagacctgatggaagcactgctcagaatctagaggac
gatcaaaactcggatgacaatagtgaggatactgatgaagaggattcagagaaactacat
gatgcattggaacattataatgcttttaaggaaaaagttaatgatgaacaacttgatgct
gattttgaaaatgaggttactaggctaatggagaatggattgcccccaaatgatgaaaat
ttaataaaaagcgatgtcggtgctaacagaagatctgataaacattcagatacagagaaa
gcgaatcaacaatttgaccaattgggagcggtagatgatatgaaccacatggagagattc
agtgacgatgaagatagcacaaccaaacgatttggtcgattgaatgatggtaggaggaaa
ccaattcatactgaagagtatgaccaaaatgaagaaggcgaacaaatatatgatgaaatg
tatgatcaaaattatgacgcgaatcgatatgacggatccagaggtgaaggtgattcgaat
gaacattatgataatttcaggaatgaggaaaatccccaattaagtctttataatcgattt
aaaaatagaagaaatgtaaaaaatgcacaacatgaggcacaagttagtgcggctactatg
gagaaatcatttgaaaaatacaaaaatactgtaaatgaagacagactagatgatgcattg
gaacactataatgcttttaaggaacaagtggatggagaaacacttgatgacgcttttgaa
aagggggttaaaaggttaaagaaacagaaccttcctaaaaatggggtacatccttcaaaa
ggtggtccacagagcggccaaaaaagaagtggaaaaatgaatggaataaataatgcaaac
agcagatttgagggaccgagaaacaatggaagtaatcaccaagccgaattggatgtgttg
aagagcaagcaaattgactcatcgaagctttacgaatacagcgataacgagcagtcagag
agatcgaaaaatgaatatgatgaacatgacgatggtgaatatggagatgatgaatatgaa
gatgagaatgatgaaggcgaatataaaaggtatgacaaatacaagggtgcagttcataaa
gcaaaaatggctgatgaccaaaggagcgatgtaaccaaaaccttaaaaaggattgatgac
agagatagtgacatccatgatcgctcaaaagatggcgacagaaatggggacagaaatgga
gacagaaatggcgatagaaatggcgatagaaatggtgacagaaatggtgacagaaatggc
gacagaaatggcgatagaaatggcgatagaaatggtgacagaaatggagacagaaatagt
gacagaaaaagtgacaaaaatgatgacaaaaacgatgacaaagatagcactataactggc
aaatccaaaaatgatgacaaagatagctttataagtggtaagtccaaaaatgatgacaaa
gatagctttataagtggtaagtccaaaaagggtgacaatgctagtactatatccggtaaa
tccatggatattagaaataagaaacttttccatctattgaaaaaggatgacgaaaattat
aaaaggcaggctgctaaattaattaactcagataattacaagaataaacttttgagtgct
atgcaacttactgacgattttaaaagaaagtttaatattttaaaacattctgtttctaca
gagaaaagattcgacgccttaaaacactatgagaagtttaaaaaggagatccttaatata
cagcttgaaagagattttatgcgtggagttaataaattaaagcctcgtagcgatactaaa
aaatcgttatatgcaccaaaagaggaatctgatgactcatatggttcatcagaggataaa
gattattctgatagtcaatctgatagatacacaaatgatgacggggatagaacacattat
gatggtgcgtcaattgatgaccgttctgatagccaatctgatagattaacgcatgatggt
aggagtaagaaagagactaatacgaaaaagaaggataactactctgatcgtcgatccgat
atatcaggacgtaataatagagataagaaagaattagttaaaaaagaaggtaagtattat
gaagacacccgttccattcgtgataaccatgattctaagagtcaatatagcgtattaagc
aagaaaaacaccccaaaaaaaagttttgctaaatcaaacaatggtactaattattataat
tctaaaagttctttggtcgtttcgaaagataataaggtggtcaagaaaatattagttaaa
tcaaaggatggtagtgtttattatggttctaagaagtcacttgttgtaagaaaagatagt
agcgcggataagaaaattttggataaaaaaaaggaccacgatgattattatggttctaag
aagtcatttgtttcttcaaaagtaaataatgatgtcgctaagaaaagtgatgacaaacca
agcggtactactgatatttgtgagactaagagcatgtatagtgtattaagtaaaaataga
tctaggaaaagccttgataagcctcgctatactactattatttgtgagactaagagcatg
tatagtgtattaagtagaaataggtctaggaaaagccttgataaaccaggtgctccttct
gaccattatggttcaaaggcttcatttcattcatccaaagacaagaaggtgcttaagagc
atttctgataaaccacacgaggagtctgattctgcaaaaccatcaaatgcgttaaaggat
gctgactcgggttcaaaaagaagcattaataaaataaacaatgaagaaaagggaaaagga
aatgataaagatgattcccattctgtgatatccttccattcattaaaagacaaaccccaa
gataaaaacaaatcatctaattcattaaattctgatgaggacaatatagatgatctatat
gacgaattagatgaagcttttaccttaaataaacaacctaaggtattaaaacaaagtaaa
gaagacttcgacaagctacatgatgatttaaaatatgatgaaaaagaatttgatacactt
tataaggtagtggaaagttatgaaaaaattgatacaaagaaatccagtagatcaagagac
aacgataacaagtctgtgaaatcagcccatatagcagatgatgataaagcctccgtgaaa
tcacatgaagaatcagaaaaggatgatgattctttgaagtcttcttacaccttgaaacgt
aaaagttttactagtaaaaaatccgacacattaaaacgcaatgataaacctatggagata
aatcaagcattcagacgcagtgaacaaaatattttacaccctgatgaattcagacgtgat
agaaattataaagattcaaatgataaagcgagaaataatagaaaagactataatagagaa
gacgattatagaagagataataataaaagggatgatcgtagaagggatgatcgcagaagg
gatgatcgcagaagggatgatcgtagaagaaatcgtagcagaaggagagatatagatgat
gactatgatataagcatagaaaatttaaaaaggaaaaaaaagagcattttacaaaaagta
ttaccatttataggagatgaagatgaaccatccaaattaagaatgtttaataagaaaggt
ttgttattaaagattgtaaaattaatcaaaaaaatagatttcatgtttgaagtagaaata
atgaattcaatgaaaagatctttaatgagtgatgctttcttgattaagccagaaacggaa
ttaaataaaacattttattacatcaagaaatataaagtacttactccaattttaataacg
ttagtatgtttagtcgcattttacgcagcaggtttaccaaatgtagcctttggtaccgtt
ttcgtacttctcgccatgatagtgtattataatatgaaattaacaaagtgtcgtaaaatg
ggcaaactgtttagatgttttagcgaaagcaataaattcgaaataagatag

DBGET integrated database retrieval system