KEGG   Plasmodium vivax: PVX_111315Help
Entry
PVX_111315        CDS       T01073                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pvx  Plasmodium vivax
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PVX_111315
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PVX_111315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 712 aa AA seqDB search
MRDETTMRDGPTMRDGPTMRDGPTRANASSGVSTPTGTDEGPPMEQHTYDVVIVGGGLFS
CCLHYFLKRKKPNITILILEKEQTLGGYIKTEWLEDQGKNFLCELGPNIFKISDDSYQLL
KELNLLSHVRVLNRKLLRYVYSGGKLHPLRLTIWGYFAFPLISVTNKVKLLYRLLFKRYK
RLSTYDEDISVEDYMRENFDLQHYNFLLLPLIYGSCGGVGSISAISFFSRNLKLFDSKMN
SLRVWQERARRGVYPVGPFDPVNRADRVDCLSGGKAGGAAPPPVGLQHSFAQRMNHTYDQ
APSFNSVLYRQDTPSGDTVGGDSVGGDTIGGDTAGGDSLGGEAHSGPVNSGPTKSGSESR
SPERGIPESGIPSNSSLSNDECATERHAGVDAMKGQRSFADTAPPVEGCLHFVKRIYAKC
KRAVLQVMPLFYPQLAKKGSKAYEQKKKKKILGKTISLKYGMYEIIDKLKKNINKKYVWT
NEEVDFVEKHNEDTWVCTIKKKHSNKTACIYGRNVILTVNSKTCANIMRKILPPEMKDNL
VNVQYTNIISVTVYYHKKDITLPPNCFGFLSADKTNHILGCFYTSNMFKERCNDDSVVVL
TLYMGGQNNPNDVYLEEKEITQIVSKELTKIFHVQNNAQPVILKVKKWFDSIPFYSHNYE
RHLKRFLNELHNPQYRNLFVDSGWITGTSISDRIASARDLSEFMAASVLAVK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatgaaacaactatgcgagatgggccaactatgcgagacgggccaactatgcga
gacgggccaaccagggcaaacgcctcaagtggggtaagcaccccaaccgggacggacgag
ggcccgcccatggagcaacacacgtacgatgtcgtcatcgtaggcgggggactcttcagc
tgttgcctgcactactttctaaagagaaaaaaaccaaacataaccatccttatcctggag
aaggagcaaaccctcggagggtacatcaaaacagaatggctagaagaccaagggaagaac
ttcctctgcgagttgggcccaaacatttttaaaatatctgacgacagttaccagctgctc
aaggaattaaacctcctgtcacacgtaagggtcctcaacagaaagctcctacgatatgtg
tattcaggtggaaagctacatccccttcgcctcaccatttggggctactttgctttcccc
cttataagtgtaaccaataaagtgaagcttttatataggctcctattcaagcggtacaaa
aggttgagcacctacgatgaggacattagcgtcgaagattacatgcgggaaaattttgac
ctgcaacactataactttctgttgctgcctttgatatatgggtcgtgtgggggcgtgggc
agcatctcggccatctcctttttttcgcgcaacctcaagctgttcgatagtaagatgaac
agtttgcgcgtgtggcaggagagggcgcggaggggagtctacccagttggcccatttgac
ccagtcaaccgagcggaccgagtggactgcctcagcggaggcaaagctggcggtgccgct
cccccccccgtgggtctccaacactcctttgcgcaaagaatgaatcacacgtatgaccag
gccccctccttcaacagcgtgctgtacaggcaggacacgcccagcggggacaccgtgggg
ggagactccgttgggggggacaccatcgggggggacacagctggcggggactccctcggc
ggggaggcgcacagtggtccggtgaatagcggccctacgaagagcggcagcgagagtaga
agccctgagaggggcatccccgagagtggaatcccctcgaatagcagtttatcaaatgat
gaatgcgcaactgaacgccacgcaggggtggacgccatgaagggccagcgctccttcgcg
gacaccgcccccccagtggaagggtgcctccacttcgtaaagcgaatctacgcaaagtgc
aaacgcgcagtcctccaagtcatgccgctgttctacccccagctagccaaaaaaggctca
aaagcatatgaacaaaaaaaaaaaaaaaaaattttgggaaaaacaatatccttgaaatat
ggcatgtacgaaataattgacaagctaaaaaaaaacataaataaaaaatacgtgtggacg
aatgaggaagtagattttgtggaaaagcacaacgaagacacttgggtgtgtaccatcaag
aaaaaacactcgaacaaaactgcctgtatatacgggagaaatgtcatccttacggtcaac
tccaagacgtgcgccaatatcatgcgaaaaatattgcccccagaaatgaaggacaatctt
gtaaatgtgcaatacacaaacattattagcgttactgtgtactaccataagaaggacata
actctacccccaaactgctttggatttttatctgcggacaaaacgaatcacatcctcggc
tgcttctacacgagcaacatgtttaaggagaggtgcaatgacgacagtgttgttgtgttg
actctatacatgggggggcagaacaaccctaatgatgtatacctggaggagaaagaaatt
acccaaattgtgtccaaagagctgacaaaaatatttcatgttcagaacaatgcccagcct
gttatcctcaaggtgaagaagtggtttgactctatccccttctattcgcacaactacgaa
cggcacttgaaacgcttcctaaacgagctgcacaacccgcagtaccggaacttgtttgtc
gattcggggtggattaccgggacgtccatatctgacaggattgcctcggcgagggacttg
tcggagtttatggcggccagcgtgttagcggtgaagtag

DBGET integrated database retrieval system