KEGG   Plasmodium vivax: PVX_114495Help
Entry
PVX_114495        CDS       T01073                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_114495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_114495
   00620 Pyruvate metabolism
    PVX_114495
   00640 Propanoate metabolism
    PVX_114495
Enzymes [BR:pvx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PVX_114495
Lipid biosynthesis proteins [BR:pvx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PVX_114495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 1053 aa AA seqDB search
MNNPESNGNITKIDSGQLNVIDIDQNIFLNKNSFPVNESYSQNDNKTGTNGNIKDVSIYK
EMYEESINNPELFWGNIAKNSVRWFKLFTKVYIGNFKKGNISWFVNGKINACDNCVDRWV
EKHPNKIAIIWEKDTPNDFKKITYQKLLERTCKIANLLKMYGVKKQDVVTIYLPMIPEIV
YTMLACARIGAIHNVVFAGYSAGSLCDRILDSNSSVLITSDFGMRGGKLTKLKQIADAAM
EMCGGAIKVCIVFKNKTKISDASRAFLESASQSAAQGSAHGNAQGNVHNTSQSASQSAAQ
SQLYHSTSADLKGADNFLAQGAARVINSQQNGVNQSEYQQMNNNKWDSAKGYFNCKPSRE
GDTPSAYACPPGEGDCVGGATSHPAEEYTNEGNHAHHAHLGHHDHRGNYDNHHNYDEHHH
HHNRDTHDSGPHGDLPRCNAPLEESAIGGGTNGGGTNSGGSKAKGVHTLHKKICKNNNLG
KKNPASDKTHYSNEIGNGHDKCSREGEATNNMGNRSNHSLEKESCDYINSVMCKSFVEAS
KESIPFEGKGYLRSDSRKSNFDENICTLKEGRDVDGSALIKNMRAYCPIEYVDSEDFLCL
LYTSGSTGKPKGVAHTTAGYLLYAYTTCKYIFDVTADDIFGCVADIGWVTGHTYVLYGPL
LNGITTVLFSSIPTYPDCGRYWSLIETHKVTQFYTAPTALRALMKHGDSYIEKYDLSSCR
ILGSVGEPINPETWRWYYNTVGKRKCVIVDTYWQTETGGIVIAPIPNLFKMKPGCASLPF
FGVQLEILDSKTLEPLNGPNVCGLLCIKSPWPGMLRTVYGNHNRLVKTYFSSCPNYYFTG
DGAYRDEDGYYWISGRIDDTLNVSGHRLGAAEIEHALVQHSCIAEAAVVSFRHVVKGEGI
LCFVVKKVGVSKKWGELEGVEGREAIEGRGAIESLDHCVDRNGNAPNANAHLSPASNLAE
MDTMHVSHTDENIIEELKLYVRRAIGPIATPDLICIVPDLPKTRSGKIIRRILRCIANEL
NDFGDITTVANHEVIDIIVNKFRDSKLKCQLGK
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaataacccggaaagcaatggaaacatcaccaaaatagattcaggacaattgaacgtc
atcgacatagatcaaaatattttccttaacaaaaactcctttccagtaaacgaatcgtac
agccaaaatgacaataagacgggcacaaatggaaacataaaagatgtaagcatatataaa
gagatgtacgaggaaagtattaacaatccagagctattttggggaaacattgcaaaaaat
agtgtaaggtggtttaaactgttcaccaaggtatacattgggaattttaaaaaagggaac
attagctggtttgttaatggaaaaattaatgcatgtgataattgtgtagatagatgggtg
gaaaaacacccaaacaaaattgcaatcatatgggaaaaagatacaccaaatgattttaaa
aaaataacttatcaaaaattgttggaaaggacctgcaaaattgccaacttattaaaaatg
tatggggtaaaaaaacaagatgtggttaccatttatttaccaatgatcccagaaattgtg
tataccatgctagcatgtgctaggataggtgcaattcacaatgtcgtgtttgcagggtac
tctgcaggcagtttgtgtgaccgtatattagactccaattcgagtgtattaattacgagc
gattttggcatgcggggagggaaactaaccaagctcaagcaaatcgcggatgccgctatg
gagatgtgtggcggcgccatcaaggtttgcatcgtttttaaaaacaaaacgaagataagt
gacgcgagtagggcattcctggaaagcgcctctcaaagtgcagctcagggcagcgcgcac
ggcaacgcacagggcaacgtgcacaacacatcgcagagcgcatcgcagagcgcagcgcaa
agtcagttataccactcaaccagcgccgacttgaaaggcgctgataattttcttgcccag
ggtgcagcccgcgtgataaatagccagcagaatggcgtgaaccaaagtgagtaccaacaa
atgaacaacaacaaatgggacagcgcaaagggttactttaactgcaagcccagtcgagag
ggggacactccctccgcgtatgcgtgcccgccgggggagggcgactgcgttggcggcgcg
acgagccaccccgcggaggagtacaccaatgaaggtaatcacgcgcatcacgcgcatctc
ggccatcacgatcatcgcggcaattatgataatcaccataattatgatgagcatcaccac
catcacaaccgtgacacccatgacagtggcccccatggagaccttccccgctgcaacgcc
cccctcgaggagagcgccatcggcggtggcaccaacggcggtggcacgaacagcggtggc
agcaaagcgaaaggtgtacacaccctccataaaaaaatctgcaaaaataacaacctgggg
aagaagaaccccgcttcagataaaacccactacagtaacgaaattggcaatgggcacgac
aagtgcagtcgcgagggagaggccacgaacaacatggggaacagaagcaaccactcccta
gaaaaagagtcatgtgattatatcaactcagtaatgtgtaaatcgttcgtggaagcatca
aaggagagcataccctttgaagggaaaggctaccttaggagtgactccaggaagagcaat
tttgacgagaatatatgcactttgaaggaaggccgagatgtggacggttccgccttaata
aaaaacatgagagcctactgtccaatagaatacgtagacagtgaggacttcctatgttta
ttatacacatccggctcgactggaaaaccaaaaggtgtagcgcatacaacggcagggtat
ttgctgtatgcctacacaacctgcaagtatatatttgacgtaactgcagatgatatattt
ggctgcgttgcagacattgggtgggtaactggccatacgtatgttttatatggcccccta
ctgaacggaataaccaccgtcttgttttcttccatcccgacgtacccagattgtggtaga
tattggagtttaatagaaacgcataaagttacccaattttacacggcacctacagcactt
agggcgctaatgaaacatggggattcttacattgaaaaatatgacctatcgtcgtgccga
attttagggagtgtaggtgaaccaataaatccagagacatggagatggtattacaacact
gttgggaagagaaagtgtgtaattgtggacacttattggcaaacagaaacgggaggaatt
gtcattgcaccgatacccaatttatttaaaatgaaacctgggtgtgctagtcttccattt
ttcggtgtccaattagaaattctagattctaaaactttggaacctttgaatggtcctaat
gtttgtggtttgttatgtatcaagagcccatggccaggtatgctaagaactgtctatggg
aatcataacaggttagtaaaaacttatttttcttcctgccccaattattattttactggg
gatggtgcgtatagagatgaagacggatactattggatatctgggcgcattgatgatact
ttaaatgtgtccggtcatcgcctaggagctgcagaaattgagcatgccttggtgcaacac
tcctgcatcgcggaggcagccgttgtttcgttccgccatgttgtcaagggggagggcatt
ctctgcttcgtcgttaaaaaggtgggcgtctctaaaaaatggggagagctggagggggtg
gaagggagagaagcgatagaagggagaggcgcgatagaatcactcgaccactgcgttgat
cgcaatggaaacgcaccaaatgcgaatgctcatttgtcacccgcttccaacttggccgaa
atggacaccatgcatgtgagtcacacggatgaaaacattatagaagaattaaagttatac
gttagacgagccataggtcctattgccaccccggatctcatttgcatagtgcctgatttg
cctaaaaccaggagtggaaaaatcattaggagaatactaagatgcatagcgaacgagtta
aacgattttggagacattaccaccgtcgcgaatcatgaagttatagacattattgttaac
aagtttagggattccaagttgaagtgccagttggggaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system