KEGG   Plasmodium vivax: PVX_115335Help
Entry
PVX_115335        CDS       T01073                                 

Definition
oxidoreductase NAD-binding domain containing protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pvx  Plasmodium vivax
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PVX_115335
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PVX_115335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 362 aa AA seqDB search
MKQTLREGLNFLSKNVVNILILVMSISCVLLFVKKNKNDKTKAEDLFELYMKANENEELK
GGKEEGQDGASMQKAFLDEKSKTLKLSKIVKLTNTVKIFIFSYPWEYTHFGLGICKHIKF
NGPNQQGKIKGKWNDREDREKDAKEIYRSYTPIYVDRKKKEVHFVIRIYSPDEHFVDGGK
MSVQLEKMRNNQTVKIAGPFGVLDYKGSNKFSYLTKAVQIKRHIVMIAGGTGMTPFFRLI
KHMLLFDAREGEQPFVTLIYANRNEEEILLKGVFDEYERTFERFKAVYSVDECLDPTKRD
TFENVGYLTEDLLRKYILKYERLGIQVDSSDTLILMCGPPPMTAFLKKILKEDIQMENVI
TL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgttgcgggaaggcctcaacttcctctcgaagaatgtcgtgaatatccta
attttggtgatgtccataagttgtgtcctcctatttgtaaagaaaaataaaaatgataaa
acgaaggcagaagatctgtttgagctttatatgaaggcgaatgaaaatgaagagttgaag
gggggaaaggaggaggggcaggatggagcttccatgcagaaggccttcttggatgaaaag
agcaaaacgttgaagctgagtaaaattgtaaagctaaccaacacggtaaagattttcatc
ttttcgtacccttgggagtatacccatttcgggttaggcatatgtaagcatataaaattt
aatgggcccaatcagcaagggaaaataaaaggcaaatggaatgatagggaggacagagag
aaggatgcgaaagaaatttacagaagctacactcctatttatgtcgataggaagaagaaa
gaggttcactttgtcattcgaatatacagcccagacgagcattttgtggatggtggaaaa
atgagtgtccagttggaaaaaatgcgaaacaatcagacggttaaaattgcgggtcccttt
ggggttctagattataagggcagtaacaaattcagctatctgaccaaggctgtgcagatt
aagaggcacatcgtgatgatagctggtgggaccggcatgactccctttttccggctgata
aagcacatgctcctgtttgacgccagggagggggagcagcccttcgtgacgctcatctac
gccaacaggaacgaggaggagattctgctcaagggggttttcgacgagtacgagcggacc
ttcgagcggttcaaagcagtgtacagcgtagacgagtgcctggaccccaccaagagggac
acgttcgaaaatgtaggatacctaacggaggaccttttgcgcaagtacattctaaagtat
gagaggttgggcatccaagtggacagcagcgatacgctcattttgatgtgcggccctccc
cccatgacggctttccttaagaagattctgaaggaggacattcaaatggaaaatgtcata
acgctttag

DBGET integrated database retrieval system