KEGG   Plasmodium vivax: PVX_116985Help
Entry
PVX_116985        CDS       T01073                                 

Definition
(RefSeq) biotin carboxylase subunit of acetyl CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pvx  Plasmodium vivax
Pathway
pvx00061  Fatty acid biosynthesis
pvx00620  Pyruvate metabolism
pvx00640  Propanoate metabolism
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01212  Fatty acid metabolism
Module
pvx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PVX_116985
   00640 Propanoate metabolism
    PVX_116985
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PVX_116985
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PVX_116985
Enzymes [BR:pvx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PVX_116985
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PVX_116985
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PVX_116985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATPgrasp_Ter ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 5474990
NCBI-ProteinID: XP_001615692
UniProt: A5K361
Position
12
AA seq 3061 aa AA seqDB search
MVNGLTGALSLVLLLQNLVEPIKHKSTNCYVHMHNNVNRNNLVNRETREAYQSSLQGGSN
ILHQSYRNRYVPLFVSKGTELLNSFFKNNRRGSRHNSTNISKSGKKSAPSSFNESGSSRA
TRSGSSHGRKWDPSKCTTREKYSERKSAVEEVADESPNRFSDGQRSSFSDDQGRSPSNHR
PSSLSDHTDEGFTSVASNEHHSGNHSPGKSHHPRNMANESGNSDDNPYLNKASYNPGEMP
DVFSNWDVAKASVRREKNVQHNFTFMMDLIKESSSMHSKSDDVMIPQNRSGDVLKDGRRL
HKGNVKKRKKHLNRLYYSFRGQNDFLSRKGGSHAGDDQSGERFYAYRGDHQAGAHTSDVC
HIPVGDSPEQQKEPTVLQRNPHRTKAHSWNSSAIDTAPPASRPNDPADFPTYEEKQRAKE
KAHQEYTTYIEERRYPYFNFAKEKNGKIIKKLLIANNGMAAMKCILSIKEWLFKTFSEEN
LIKIIVLATEEDISSNAKYISLANKVIKVPPGKNCNNYANVPLIVEVAKKEQVDAVWPGW
GHCSENPLLPTMLERENIIFIGPTGDVMEALGDKISANILAQSVNVPVVKWSGDSIRIDN
FDSKIGEDVYNKSTIHSLDACIKECQRIGYPVMIKASQGGGGKGIRKVENEAEIKKAYEQ
VQMELPNSPIFLMKVCSNVRHIEIQVVGDMYGNVCSLSGRDCTTQRRFQKIFEEGPPSVV
PPDIFREMEKASIRLTKMIKYRGAGTIEYLYDQEKQTYFFLELNPRLQVEHPVSEGITDT
NLISIQLQVAMGVPLQNIDDIRRLYRIGGGSSGHSVHSVHSGGSGGSVSGGGSVCSGGSV
CSGGSERGSQTKECAPPRAEQADAFDFYNHRPHVRNHVIAARITAENSNDSFKPTSGKVQ
RIHFQNAKDVWGYFSINDGSVHEFSDSQIGHIFAKGETREVARKNLILSLRKLNIEGEIK
TGTRYLAKILECKPFIQNNITTNWLDTIIEKKKNIYYSAVHIIILCATIFKLLIYFTKEK
EDIEDALSREDIGIKSQGDSPANLKREVKKAYTFDLVFENVRYNFKAHNTGENLYTLKIN
GQEIEVLADYDKKNNKIFASFFNHTYLYTCSEDSLGIHMHLEKDSIFIPKMSNPFHLVSN
TNGKIVKYLIKDGEKVGKNEDYIEVEAMKMIMTFKSTEKGILRHRMSEGTIVKVGDLLGV
IEQTSHGSGTHPGEQNEIKTFTGHLDLSNKYAYELEEASRLTHPLGFVATDRSTEGIWPI
GDQDAGKSHSHMDDANRGEEDTPTVAPNNARSETHRLSEHTGGTHVVEAPKLEDSSSFSS
FEQDEVSSRERITKNRLFLKQKKNIFRLFASKRGSDKGEHTAASYLNEKFNSVKAYLTSL
SSSSASSAAPTSASTSVKVGEEEVEEAADVEAAVEESAEAAAEAADVEAAQTNKSCANGL
SRAHTVNDESGSANRGSSSTGLNSTCQNSLTSERGDRNDHLSSEVVSTRNASNEKASNAG
TLSWGAAHRGSSAGASAGASAGESAGVSAGASPGASEGTSKCTSNSCTQVGGDSPGVASP
SGHPSGNPNTGEDLRRNQFLLDIPNMKRIEYLLKGYEQDYQQCFNELVKEKKNLNREFAY
ILDKFVEYNSLFAQKENITQVEAYDILHTMVKNEKKKNYEIAHAYTYNYLSIKFVELVLK
YLLDSGLTPLSEMPQDLLDKLKVISSLRGKCFGNVILLARAIVHIVEHTRLVKLVKCALE
DRNATFDEQINQLEELLKMKQRIFAHSKLGKLPMGASSPSSSYGNHCERVVNAFLGSPSD
VHMFLPSLFTQENKKALLEIYARNLYTHFDVKAELVGEDCLKFFINNSEEENLLLLNERN
RVDVDELISKGGINPTGGLINSIHIINRNGNFLNDYEGGIEHIKKRCKHLYVYHYFGESY
GDVYEWVGEGDPGEELHWRQSKNELPHRRTNLLPYQRYILSFERNRQNYDLENVDEKIFK
GTKVFLGKYKKNNKIESLFAERVIHLSELPESGASELRETPPKGGNTLGEQNRLEDALAE
EFQEAVKDVAIARLNPKVQDAKVSSYITYHVVLEEVKGKDELDVIVEALKNFLNRHNEML
LENYVNDVYACVYRKGGESAKGRPQLAPQKVFRLHVLFDGESNVIEEVEGVPPFDVDALY
LKRKRAREIDTLYAYDFVKVINISLNRMNGGGPGDLFTYVNSVREFRLDLEALQGGNTTK
EGHTTKEGHTTKEGHTTKEGHTTKEGHTTKEGHTTKEGHTTKEGHTTKEGHTTKEGHTTK
EGHTTKEGHTTKEGHTTKEGHTTKESHTTKEGHTTKESHTTKESHTTKESHTTKEDATRA
DLLLPRQDGLSEDEAKIRKALHLSDELNVGQNKLSVIGLLMNVKTDEYKEGRDVIFIIND
ITTHGGSFSVVEDQLFYAISSYAREKKIPRIYISCNSGARIGLYNFLMDKIQVSWKDEEK
KELGYDYIYITEEVKSRIAKEDIIFLKEITQNGEKRYIVEGIVGNLNSHIGVENLRGSGL
IAGETSKAYDEIFTLSYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGEKV
YVSNEQLGGVKIMMRNGISQLEAQNDQDGVDKIFKWLSYVPKTSDHYYDVIEKALEGRSE
IINYERANGEEAHNMVREPSQVESQPTPQKEPPKSYFQRINDIDMDGLQNADIVELISGT
DSKQGFLDKHSYFEYMNEWGKGILTGRGKLGSIPVGVIAVNRNLVTQVTPCDPALKTKAV
RSTHAPCVFFPDNSYKTAQSIEDFNKENLPLFVFANWRGFSGGTMDMFNSVLKFGSMIVN
QLVNYKHPVFVYIPIFGELRGGSWVVVDETLNSQIIEMYADTNSKGGILEPPGIVEVKFR
LPEIRKLMHGIDSSIIALDERLAEAQEPDDVSRIKQEIEEKEKELLPFYLQVCHRYADLH
DVSKCMKSKGVIRKIVPWEKARSFFYYRLVRRLLMSTLSKKYGTALTQSEEFKKLTSDIA
SSDEEDYEVCRRILNESTLRDIERLTQDLQHRKTLDEFYRAFQSLPPQQRRELFSKLSSH
E
NT seq 9186 nt NT seq  +upstreamnt  +downstreamnt
atggttaatggcctcacaggagcactctcgcttgtcctgctacttcaaaaccttgtagag
cccataaaacacaaaagcacgaattgctatgtacacatgcataataatgtcaataggaac
aacttggtcaacagagaaacgagggaagcataccagagtagcctacaggggggcagtaat
atccttcatcagagttacaggaacaggtatgtgccgctgttcgtgtccaagggaaccgag
ctgttaaactcgttttttaagaataacaggcggggaagcagacacaactcgacgaacatt
tcgaagagcgggaagaagagtgcgccctcttcgtttaatgagagtgggtcctcgcgcgcc
actagaagcgggtcttcacatgggcgaaaatgggacccaagcaagtgcaccacgcgggag
aagtactctgagcgaaagagcgccgttgaagaagtagcagatgaatcgcctaaccgcttc
agcgacggccagcggagcagcttcagcgacgaccaggggagaagccccagtaaccaccgg
ccgagcagccttagcgaccacacggatgaaggctttaccagtgtcgcatccaatgagcac
cacagcgggaaccacagcccagggaaaagccaccacccgaggaatatggccaatgaaagt
gggaacagcgacgataacccctatttgaataaagctagctacaacccaggggagatgccc
gatgtgttttcaaattgggacgttgccaaggcgagtgtaagaagggaaaaaaacgtacaa
cacaattttacttttatgatggacctgattaaggaatcctcctccatgcactccaagagt
gacgatgtgatgattccgcagaaccgttctggagatgttctaaaggatggtagacggttg
cacaaagggaacgtaaaaaagaggaagaaacatctgaataggctgtactacagttttagg
ggccagaatgattttctctcgcgaaaggggggctcccacgcgggggatgatcaaagtgga
gagaggttttacgcatatcggggagaccatcaggcaggtgcccacaccagtgatgtgtgc
cacatcccagtaggggactctcccgaacagcaaaaagaaccaaccgtgttgcagcgaaat
ccgcaccgtactaaagcgcacagctggaatagcagcgctatcgatactgcccctcctgcc
agtcgcccgaacgaccccgccgacttcccaacgtacgaagaaaaacaaagggcgaaggaa
aaggcccaccaggaatacacaacatacatagaagagagaaggtacccatattttaatttc
gcaaaagagaaaaatggaaagataataaaaaaactgctaattgcaaataacggaatggca
gcaatgaagtgcatcttgtccataaaggaatggctctttaaaactttctcagaggaaaat
ttaattaaaatcatagtgctagccacagaggaagatatttcaagcaatgccaagtacatt
tcgttggccaacaaagttataaaggtacctcctgggaaaaactgcaacaattacgccaat
gtgccgctaatcgtggaagtggcgaaaaaggaacaagtggatgccgtctggccaggatgg
ggacactgctcggaaaatccgctactccccaccatgctggaaagagaaaacatcattttt
atagggccaactggagatgtaatggaagctttaggagacaaaatatctgccaatatcctc
gcgcagagtgtaaatgtacccgttgtaaaatggagtggagatagcatccgaattgataat
tttgatagcaaaattggggaagatgtatacaataaatctaccatacattcgttagatgct
tgcataaaggagtgccaacggattgggtaccctgtgatgataaaggcatctcaaggaggg
ggggggaaaggcattcggaaagtagagaacgaggcagaaataaagaaagcgtatgaacaa
gtgcagatggaactacccaactcgccaatctttttaatgaaagtctgtagcaacgttaga
cacatcgaaatacaagtcgtcggagatatgtatggcaatgtgtgttccctaagtggaaga
gactgcacgacccaaaggaggttccaaaaaatttttgaagaagggcccccctcagttgtt
cctccggatatcttccgcgaaatggaaaaggcatccatacgtctgacgaaaatgataaaa
tataggggtgcggggacgattgagtatctgtatgaccaggagaagcagacttattttttt
ctcgagttgaatcctcggctgcaggtggagcaccccgtttcggagggaatcaccgacacg
aacctgatttcgatacagctgcaggtggccatgggggttcccctccagaacattgacgac
atcaggaggttgtaccgcatagggggggggagtagcggccatagcgtccatagcgtccat
agcggtggtagcggtggtagtgtcagcggcggtggtagtgtctgcagcggtggtagtgtc
tgcagcggtggtagcgaacgggggagccaaactaaggagtgcgcccccccgcgcgcggag
caggcggacgcgttcgacttctacaaccaccggccgcacgtgcgcaaccacgtgattgcc
gcgagaatcacagcggaaaatagcaacgacagttttaagcccacgtcgggaaaggtacaa
agaatccatttccaaaacgcgaaggacgtgtgggggtacttctcaatcaatgacgggtcc
gtacatgaattttccgattcacaaattgggcacatttttgcaaagggagaaacgagggaa
gtagccagaaaaaatctaatcctctcattaaggaagctaaacatagaaggggaaataaaa
acaggcacaaggtacttggcaaaaattttagaatgcaaaccttttattcaaaacaacata
acgaccaattggctggacacaataattgaaaagaagaaaaatatctattacagcgcagtg
cacataataattttatgcgcaacgatatttaagctgctcatttattttaccaaggaaaaa
gaagatatagaagatgcgctaagtagagaggacattggcattaaatcacagggagattcc
cccgctaacttgaagagggaggtaaaaaaggcctacacatttgacctcgtatttgaaaat
gtgaggtacaattttaaggcccataatacaggggagaatctttatactctaaaaattaac
gggcaggaaatagaagtgctagccgactacgataagaagaataataaaattttcgccagc
tttttcaaccacacgtatttgtatacatgctcggaagatagcttaggtattcatatgcac
ctggaaaaggacagcatttttatccccaagatgagcaacccatttcatttggtgtccaat
acgaatgggaaaattgtaaaatatttgattaaggatggggagaaggtagggaagaatgag
gactacatagaagtagaggccatgaaaatgattatgacttttaagtctacagagaagggc
atactcaggcacaggatgtccgagggcaccatcgtcaaagtgggggacctcctgggagtg
attgagcaaacctctcatggtagcggcactcatccgggagagcaaaacgaaattaaaact
tttacaggtcatttggacttgtccaataagtacgcctacgaattggaagaagcgagtcga
ctgacgcaccccctcggttttgtcgccacggataggtctacggaaggcatctggccgatt
ggcgatcaagacgcggggaaaagtcactctcatatggacgatgcaaatcggggcgaggaa
gacacaccgacggttgcgccaaacaatgcgcgaagtgaaacgcatcgcctgagtgaacat
accgggggaacacacgtcgtggaggcccccaagttggaggattcctcctccttttcctcc
ttcgaacaggatgaagtgtcatccagggagagaatcaccaagaaccggctattcctaaag
cagaagaaaaatatatttcgcttatttgcgagcaaacggggcagcgataaaggagagcac
accgcggcgagttacctgaacgagaaatttaactccgtcaaggcgtacctcaccagtttg
agctcgtccagcgccagctcggcggctcccacgagcgccagcacgagcgtcaaggtggga
gaggaggaagtggaggaagcggcagatgtggaagcagcggtggaggaatcggcagaggca
gccgcggaggcagcagatgtggaagccgcgcagacgaacaagtcgtgcgctaatggactg
tccagggcgcacacagtgaatgacgagtctggaagtgccaaccgggggagcagctccacc
ggtctgaactcaacctgccagaactctctgacgagcgagaggggggaccgcaacgaccac
ctgtcgagcgaagttgtgtccacgaggaatgcctccaatgagaaggcgtccaacgcgggc
accctcagttggggcgcggcgcacagggggtcgtcagcaggggcatcagcaggtgcgtca
gcaggggaatcagcaggagtatcagcaggagcatcaccaggagcatcagaaggcacctct
aaatgcacctcgaacagttgcacccaagtggggggggactccccgggagtggcttctccg
agtggtcacccgagcggcaaccccaacaccggcgaagacctcagaagaaaccaattcctg
ttggacatccccaatatgaagaggatagaatacttgctgaaggggtacgagcaggactac
caacagtgcttcaacgaattggtgaaagaaaaaaaaaacctcaaccgtgagtttgcgtat
atcctagacaaattcgtagagtacaattccctttttgcccaaaaggaaaacatcacgcag
gtagaagcgtatgacattctacacaccatggttaaaaacgagaagaaaaaaaactacgaa
attgcccatgcgtatacgtacaactatttgagcataaaatttgtggagctcgttttgaaa
tatttactggacagtgggttgaccccgctcagtgagatgccacaggacctcctagacaag
ctaaaagtgatatcatcccttagggggaaatgtttcggcaacgtcattttgctagccagg
gcgatagtacacatcgtggaacatacgcgcttggttaagctggtaaaatgtgccttagag
gataggaatgccacttttgatgaacaaattaaccaactggaggagctcttaaagatgaag
cagcgaatctttgcacattcgaaattggggaaacttccaatgggtgcatcttctccctcg
agcagctatgggaaccactgcgaacgtgtggtgaatgcatttttgggaagcccctcggat
gtacacatgttccttccgtcgctttttacgcaagaaaataaaaaggcactcttagaaata
tacgctcgcaatttatatacccactttgatgtgaaagcagagctagtgggggaggactgc
ctgaaattttttataaacaattcggaagaagaaaatttactcctcctaaatgagagaaat
agggtagatgtagatgagctgatttccaaaggggggatcaaccccactggtgggctcata
aacagcattcacattattaaccgaaatgggaatttccttaatgactatgaagggggtata
gagcatataaagaaaaggtgtaagcatttgtacgtttatcactactttggggagagctat
ggggatgtttacgagtgggtaggagagggagaccccggggaggagctccattggcggcaa
agcaaaaacgaactaccacaccgcaggacaaatctgctgccctaccaaaggtatatcctc
tccttcgaaaggaaccgccaaaattacgatttagaaaatgtagatgagaaaatatttaaa
gggaccaaggtattcctggggaagtacaaaaagaacaacaaaatagagtctctgtttgca
gagagggtgatccatttgagtgagcttccagagagtggagcgtctgaactgagggaaact
cccccaaaaggggggaacaccctgggggagcagaaccggttggaagacgccctcgcggag
gagttccaagaagcggtgaaggacgtagcaatagctagactgaacccgaaggtgcaagac
gcaaaggtgagcagctacataacctaccatgtggtgctggaagaggtgaaggggaaggac
gaattggacgtaattgtagaggcgctgaagaacttcctcaataggcataacgagatgctt
ctagaaaattacgtgaacgatgtgtacgcctgtgtgtacagaaagggaggcgaatctgcg
aaggggcgaccccaattggcaccgcaaaaggtattcagactgcacgtcctcttcgacgga
gaaagtaacgtcatcgaagaggttgaaggtgtccccccgtttgatgttgacgcgttgtac
ttaaaaaggaagagggctagagagatagacacgttatatgcctacgattttgttaaggtt
ataaatatctccctaaacaggatgaacggaggcgggcccggggatctgttcacgtatgtg
aacagcgtcagggagttcaggctggacttggaggcgcttcagggggggaacaccacaaag
gagggtcacaccacaaaggagggtcacaccacaaaggagggtcacaccacaaaggagggt
cacaccacaaaggagggtcacaccacaaaggagggtcacaccacaaaggagggtcacacc
acaaaggagggtcacaccacaaaggagggtcacaccacaaaggagggtcacaccacaaag
gagggtcacaccacaaaggagggtcacaccacaaaggagggtcacaccacaaaggagggt
cacaccacaaaggagagtcacaccacaaaggagggtcacaccacaaaggagagtcacacc
acaaaggagagtcacaccacaaaggagagtcacaccacaaaggaggatgctacccgtgcc
gatctgctgcttccccggcaggacggcctcagcgaagacgaagcgaagataaggaaggcg
ctccacctgtcggacgagctaaacgtgggccaaaacaaactgagcgtgatcggcctgctg
atgaacgtgaagacagacgagtacaaagaaggaagagacgtcatttttattataaatgat
ataacgacgcatggggggtccttcagtgtggtggaagaccagctcttttacgccatatct
agctacgccagggagaaaaaaatcccccgcatctacatatcgtgcaattcaggggcgaga
attggactctacaactttttgatggacaaaattcaagtgagttggaaagacgaagaaaaa
aaggaactcgggtatgactacatttacataacagaagaggtgaaaagtaggatagccaaa
gaggatatcatttttttgaaggaaattactcaaaatggagagaagagatatatagtagaa
ggcatagtgggcaacctaaacagtcacattggtgtggagaatctgcgggggagtggcctc
atcgctggcgaaacgtccaaagcgtatgatgaaatttttaccctctcctatgttactggc
aggagtgttggcatcggtgcgtatctggttagactcgggaaaagaaccatccagaaaaag
ggctcttctcttttgctaacagggttcaacgcgcttaacaaaatattaggggaaaaggtc
tacgtcagtaatgaacaattagggggggtgaaaattatgatgaggaatggcatatctcag
ctggaggcgcaaaatgatcaggacggtgtggacaagattttcaagtggctctcctatgtg
ccaaaaacgagtgaccactactacgacgttattgagaaggccctcgaggggagaagtgaa
attataaattatgagcgggctaacggggaggaggcacacaacatggtgagggaaccctcc
caggtggagagccaacccactccgcagaaggaacctccaaaaagttacttccaaagaatt
aacgatatagatatggatggcctacaaaacgcagatatagtggagctgataagcgggaca
gactcaaagcaggggttcttagacaaacatagctacttcgaatacatgaacgagtgggga
aaagggattctaaccgggagggggaaattgggttccatccccgtaggagttatagccgtt
aaccgaaatttagtaacgcaggttactccgtgcgacccagcactgaaaaccaaagcagtg
aggtccacacacgcaccatgtgtttttttccctgataattcatacaaaacggctcaatcg
attgaggattttaataaagaaaatttacccctcttcgtttttgccaattggagaggtttt
tcaggtggcaccatggatatgtttaacagcgttttaaaattcggctcaatgattgttaac
cagttggttaattacaagcaccccgttttcgtgtacatcccgatttttggggagctgaga
ggtgggtcgtgggtcgtcgtggacgaaacgctaaatagccaaatcatcgagatgtatgcg
gacacgaacagtaaaggcggcattttggagccaccaggcattgtcgaggtgaagttcagg
ctgcccgaaattaggaagctcatgcacgggattgactcgtctataattgccctggacgag
cggctggcggaggcgcaggagcctgacgacgtgtccagaataaaacaagaaatcgaggag
aaggaaaaggagctgctgcctttttatttgcaagtgtgccaccgatacgcagatctgcac
gatgtgtccaaatgcatgaagtccaagggggtgatcaggaaaatcgttccttgggagaag
gcccgctccttcttttactaccgcctcgtgcggcgcctgctgatgagcacgctgagcaaa
aaatacggaaccgctctaacccaaagcgaagaattcaagaagctcaccagcgacatcgcc
tcctcggacgaagaggactacgaggtgtgcaggagaattttaaatgaaagcactctgagg
gatatagagcggctaacgcaggacctgcagcaccggaagacgctggacgagttttacagg
gcctttcaaagcttgcccccccagcagaggagggaactctttagcaagctgagttcgcac
gagtag

DBGET integrated database retrieval system