KEGG   Plasmodium vivax: PVX_117100Help
Entry
PVX_117100        CDS       T01073                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pvx  Plasmodium vivax
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PVX_117100
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PVX_117100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 528 aa AA seqDB search
MKGSICLHTLLLLVGMQEMGAGRVCPQRGERKRAYVINMKRGSVQNGGARRGLWSGRVKF
RKREDLSRGGRGPECAVNAVNAASAANNGNPANAANDANASNPSNRANRANPANCINVAI
FGSSGSIGANALDVIRECNRVERRFNVEALYVNKSVTKLYEQAREFLPKYVCIHDESKYE
ELKMLLRKIKGYNPEILVGDDGMKQMCSSNTLDRIIIGIDSFHGLYSTIYAIKSNKIIGL
ANKESIVSAGFFLKKLLTSHTKSCIIPVDSEHSAIFQCLDNNKVLKTKCLQDSFSKVNQI
KKLILSSSGGPFQNASLDELKKVTAEDALKHPKWKMGPKITIDSATMMNKGLEVIEAHFL
FDVDYNHIEILVHKECILHSCVEFIDKSVVSQMYLPDMKLPILYALTWPNRIATELPSLN
LASTSPLTFYSPSLDHFPCIKLAYQAGRQGNFYPTVLNAANEVANKLFLSNKIGYFDIAA
IISDVLESFTPQEVSNNCEDLMHQIGGIHKWAVRRAEEVYRVRSSAAQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggtccatttgtttgcacaccctgttgttgctcgtcggcatgcaggaaatgggg
gccggtcgtgtgtgcccccaacgtggtgagaggaaaagggcgtacgtaataaatatgaaa
cgggggagcgtgcagaatggtggagcgaggcgagggctgtggtccgggcgggtaaagttt
aggaagcgggaggacctctcccgtgggggcagaggccctgagtgcgcggtgaacgcggtg
aacgcggccagcgcggcaaataatggcaaccccgctaacgccgctaacgatgctaacgct
tctaacccctctaaccgcgctaaccgcgctaaccccgccaactgcatcaacgtggccatc
ttcgggagcagcgggagcatcggcgcgaacgcgctggacgtgattcgcgagtgcaaccga
gttgagaggcgcttcaacgtggaggccctgtacgtcaacaaaagcgtgaccaaactgtat
gaacaggcaagggagtttttgccaaagtatgtgtgcatccacgatgagtcaaaatatgag
gaattaaaaatgttgttaagaaaaataaagggatacaacccagagatactagtgggggat
gatggcatgaaacaaatgtgcagcagcaacacactagacagaattataattgggatcgac
tccttccatgggttatactcaaccatatatgcaattaaaagcaataaaattattgggcta
gcgaataaagagtcaatcgtatctgcaggattttttctcaaaaaattattaacaagtcat
acaaaatcgtgcattattccagtggactcagaacacagtgccatcttccaatgtttggat
aataacaaagttttaaaaacgaaatgtctgcaggatagcttctccaaagtgaatcaaata
aaaaaattaattttatcctcctcaggtggcccctttcaaaatgcctcccttgatgagctg
aaaaaagtaaccgcagaagatgccctcaaacatccaaagtggaaaatgggacccaaaata
accatcgactctgcaactatgatgaacaaagggttagaggtgattgaggctcatttcctc
ttcgacgtagattacaatcatatagaaatccttgtgcataaggaatgtattctccattcg
tgcgtagaatttatagacaaatcggttgtaagccaaatgtacctcccagatatgaagctt
ccaattctatatgctttgacttggcctaatagaattgctacagaattgccgtctcttaat
ttggctagtacgtctccccttacattttactccccctcactggaccacttcccttgtatc
aagctggcgtaccaggcaggtcggcaggggaacttctacccaactgtcctcaacgcggcc
aacgaggtggccaacaaactatttctaagtaacaaaattggctactttgacattgccgcc
atcatatctgacgttttggagtccttcacgccgcaggaggtctccaacaactgcgaggat
ttgatgcaccaaattgggggcatccacaagtgggccgtccgcagggctgaggaggtgtac
cgggtgcgctcctccgcagcgcagtga

DBGET integrated database retrieval system