KEGG   Plasmodium vivax: PVX_117280Help
Entry
PVX_117280        CDS       T01073                                 

Definition
(RefSeq) cyclin homologue
  KO
K06634  cyclin H
Organism
pvx  Plasmodium vivax
Pathway
pvx03022  Basal transcription factors
pvx03420  Nucleotide excision repair
Module
pvx_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PVX_117280
  Replication and repair
   03420 Nucleotide excision repair
    PVX_117280
Transcription machinery [BR:pvx03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PVX_117280
DNA repair and recombination proteins [BR:pvx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PVX_117280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2
Motif
Other DBs
NCBI-GeneID: 5475048
NCBI-ProteinID: XP_001615750
UniProt: A5K3B9
Position
12
AA seq 326 aa AA seqDB search
MNYPEDTSHMTKWIFKSKNEVDEICLKKYNDFKEKFKDHNVSIPKYAEIEKTKLYFCYQL
THFCEIKRLKSQIVECAIVLYNRFYLKEIILEYDPRILIFTCIILAIKLEGYGRLYKMND
FFNDIDINLDKVLEHENVVCSSLDFEINFLYTKECIFYLKSKFLNYINKYINKDNEIQNS
FENICNQIYVNTVQDCLKIIESFTITFTYTPAQIALYCFVNNIKINFNIVNADKFILEFI
TNNNQILFQKLKNKIDELHVRYKDHLDLRNTFDDENTTRQIGETLDMCIDIYEILKKKKS
SKKSKKKKLSSEDCERGEAAKRVDMK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattacccagaggacacttcgcacatgaccaaatggatcttcaaaagcaaaaacgag
gtggacgaaatatgcctaaaaaagtacaacgactttaaggagaaatttaaagaccacaat
gtgagcatcccaaaatatgccgaaattgaaaaaacgaagctttacttttgttaccaactg
acgcacttttgtgaaatcaaaagactgaaatcgcaaatagtggaatgcgcaattgtgctg
tacaacagattttacttaaaagaaattatattggagtatgacccacgtattttaattttc
acgtgcataatcttagcaataaagttggaaggatatggacgcttatacaaaatgaacgat
ttttttaacgacattgacattaatttggacaaagtacttgaacatgaaaatgtcgtatgc
tcatctctcgattttgaaatcaactttttgtacacaaaagaatgtatcttttacttaaaa
agtaaattcctaaattatataaataaatatataaacaaagataacgaaatacaaaattca
tttgaaaatatttgcaatcaaatttacgtcaacacagtacaggactgcttaaaaattatc
gaaagttttaccattacatttacgtatacacctgcacaaatagcactctactgctttgta
aataatataaaaattaattttaacatagtcaatgctgataagtttattctcgaatttatt
accaacaataatcaaattctttttcagaaattgaaaaacaaaattgatgagctccatgta
aggtataaggaccacctcgatttgaggaacacctttgacgatgaaaacacaactagacag
atcggagaaacgttggacatgtgtattgatatttacgaaattttaaaaaaaaaaaaaagc
agcaaaaaatcgaagaagaaaaagttaagcagcgaggattgtgagcggggggaggccgcc
aaaagggttgacatgaagtag

DBGET integrated database retrieval system