KEGG   Plasmodium vivax: PVX_117435Help
Entry
PVX_117435        CDS       T01073                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pvx  Plasmodium vivax
Brite
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PVX_117435
Peptidases [BR:pvx01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PVX_117435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 228 aa AA seqDB search
MLRNNVWVPIESNPEALYLYSCKLGQTKLAFQDIYGFDAELLDMIPQPVHAIILLYPLKE
GMVTPNAATDGSAEQNIDNIWFIKQVVPNSCGTVALFHLYGNLKNKFELDKDSLLANFFD
KVKDMSPEKRGQEFEVNKSIELLHHEFSGKSSGTGDDIDVDTHFIVFLEIDGRLVELDGR
KDHPVIHCPTTPASFKYDTGSVIQKKFIEKCEDDNRFSALAVVSSDVV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcaacaacgtttgggttcccatcgagtccaacccggaggccctctacctgtac
tcctgcaaacttgggcagacaaagttggcgtttcaggacatctacgggtttgacgcggag
ctattagatatgatcccgcaacctgtgcatgcaataatactgttgtaccccctgaaagaa
ggcatggtcacccccaatgctgcaaccgatggaagtgctgaacaaaacattgacaatatt
tggttcataaaacaggttgttccgaattcttgcggaacggtggcccttttccacctctac
ggaaatttaaagaataaattcgagctggacaaggactccctcttggccaattttttcgac
aaggtgaaggacatgtcgcccgagaaacgaggccaggaattcgaagtgaacaagagcatc
gaactgcttcatcacgaattttccggaaagtcctccggcacgggggatgacatagacgtt
gacacccacttcatcgtctttctcgaaattgacgggaggctcgtcgagctggacggaagg
aaggaccatcccgttattcactgcccgacaactccggccagtttcaaatacgacacggga
agtgtaatacaaaaaaagttcatagaaaagtgcgaagatgacaacagattttcagcccta
gcagttgtatcaagtgacgttgtgtag

DBGET integrated database retrieval system