KEGG   Plasmodium vivax: PVX_117895Help
Entry
PVX_117895        CDS       T01073                                 

Definition
(RefSeq) calcineurin B subunit isoform 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pvx  Plasmodium vivax
Brite
Protein phosphatases and associated proteins [BR:pvx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PVX_117895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 MotA_activ
Motif
Other DBs
NCBI-GeneID: 5475170
NCBI-ProteinID: XP_001615872
UniProt: A5K3P1
Position
12
AA seq 177 aa AA seqDB search
MGNTQAILSEKDQKDLLQAANFSEVDIKKMYKRFVELDTNKNGQLDPNELFDVPEISDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLASSTDDFQKKKFAFDIYDINKDGMISNGELF
TVMKMMVGNNLNDIQLQQLVDRTILQADKDGDGMISFEEFKDMISHMDVGNKLKLDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacaagcaatattatcagagaaagaccaaaaggatttgttacaagcagct
aattttagcgaagtggatataaaaaaaatgtacaaaagatttgttgaacttgacacaaat
aaaaatggacaactagatccaaatgaattattcgacgttcctgaaataagtgacaaccca
ctagtcaaaagagtcatctcaatctttgattccaactcggatggaaaagtttctttcgtg
gaattcttagttggcataaccaagctagcctcgagcacggacgacttccagaagaaaaag
tttgccttcgatatctacgacattaataaggacggaatgatatccaacggggagctgttc
accgttatgaagatgatggtggggaataacttaaatgacatacagttgcagcagctggtc
gaccgaaccattctacaggccgataaggatggagatgggatgatttccttcgaagaattt
aaagacatgatatcccacatggacgttggaaataaattgaagctagatctgtag

DBGET integrated database retrieval system