KEGG   Plasmodium vivax: PVX_117895Help
Entry
PVX_117895        CDS       T01073                                 

Definition
calcineurin B subunit isoform 1
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pvx  Plasmodium vivax
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 177 aa AA seqDB search
MGNTQAILSEKDQKDLLQAANFSEVDIKKMYKRFVELDTNKNGQLDPNELFDVPEISDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLASSTDDFQKKKFAFDIYDINKDGMISNGELF
TVMKMMVGNNLNDIQLQQLVDRTILQADKDGDGMISFEEFKDMISHMDVGNKLKLDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacaagcaatattatcagagaaagaccaaaaggatttgttacaagcagct
aattttagcgaagtggatataaaaaaaatgtacaaaagatttgttgaacttgacacaaat
aaaaatggacaactagatccaaatgaattattcgacgttcctgaaataagtgacaaccca
ctagtcaaaagagtcatctcaatctttgattccaactcggatggaaaagtttctttcgtg
gaattcttagttggcataaccaagctagcctcgagcacggacgacttccagaagaaaaag
tttgccttcgatatctacgacattaataaggacggaatgatatccaacggggagctgttc
accgttatgaagatgatggtggggaataacttaaatgacatacagttgcagcagctggtc
gaccgaaccattctacaggccgataaggatggagatgggatgatttccttcgaagaattt
aaagacatgatatcccacatggacgttggaaataaattgaagctagatctgtag

DBGET integrated database retrieval system