KEGG   Plasmodium vivax: PVX_118480Help
Entry
PVX_118480        CDS       T01073                                 

Definition
delta-aminolevulinic acid dehydratase precursor
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pvx  Plasmodium vivax
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PVX_118480
Enzymes [BR:pvx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PVX_118480
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PVX_118480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 451 aa AA seqDB search
MIKINGIILLYFSVLNLVCCLNSNFCKSAYILYSPQSTKRYKAPFRRWNSPQNNNNLSDL
RKDQKSTEDVYNENVARQSDLKNFAKDINDNVYIETNRRERRIKRNRHLRSLYSNNSIRM
SNFIYPMFIHEEDAPKKETQLDGIHTYSVDGIVKEIEECLQLNIHHFMFFPVVKEEKKTT
YCSECYNESSYFCNAINKIKQKFKDQIVIYVDVALDPYNIYGHDGIYDEREGEILNDVTV
HTLVKQALCLAKCGADVVCPSDSMDNRIEQIRKNLDFHNFRNVLILSYTCKYSSCLYKPF
RSILNSNIHKNVVKNKQSYQHDFNAYFDLNHVEKHIAEGADILMVKPSLFYLDVVSRIRS
RMDKHATVPLAVYNVSGEYMMIKNYVKQLNAHINYENEILTELFKSYLRSGANIIISYFA
KQYGLYLKDLYDRNVDVDDDLNSNFNVELTL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaataaacggaataattttgctttacttttctgtgctcaatttggtgtgttgt
cttaatagcaacttttgtaaaagcgcctacattttgtactctccccagtcgacgaagagg
tacaaggcccccttcagaagatggaatagcccacagaacaataacaatttgagcgattta
agaaaagaccagaaatcgactgaagatgtgtacaacgaaaatgtggcaaggcaaagcgac
ctgaaaaattttgcaaaagatataaacgataatgtctacatcgaaacgaataggagggaa
aggaggataaagaggaataggcacttgcgttccctatacagtaataatagcatacggatg
tccaattttatttacccgatgttcattcatgaggaggatgcccccaagaaggaaacccag
ctggatggaatccacacctacagcgtagacggaatcgtgaaagagatcgaagaatgccta
caattgaatattcaccactttatgtttttcccagtcgtgaaggaggaaaaaaaaacgacg
tactgctccgaatgctacaacgaaagtagctacttctgcaacgcgataaacaaaataaaa
caaaagtttaaagaccaaattgtcatttacgtggacgtggctctggatccgtacaacata
tacgggcacgatggaatatatgacgagcgggagggggaaatactcaacgacgttacggtg
cacacgctggtgaagcaggccctatgcctagccaagtgcggcgccgacgtggtgtgtccc
agcgattccatggacaacagaattgaacaaattaggaaaaacctggactttcacaacttc
agaaacgtcctcatattgtcctacacgtgcaagtactcctcatgtctctataagccattt
agatccatcctgaattccaacattcacaaaaacgtcgtcaaaaataagcagtcctatcag
cacgacttcaacgcgtactttgacctcaaccatgtggagaagcacatcgccgaaggggcc
gatatcctcatggtcaagccgtcgctattttacctagacgtggtcagccgcattagaagc
agaatggacaaacacgccacggtgccgctggctgtttacaacgtctctggcgaatacatg
atgatcaaaaattacgtcaaacagttgaatgcacacataaattatgaaaatgaaattctg
acggagctctttaagagctacctacgatccggggcaaacataattatcagctacttcgcc
aagcagtatggtttgtacctcaaagatttgtatgaccgtaatgtagacgtagacgacgat
ttgaacagcaattttaacgtcgaattgacgctataa

DBGET integrated database retrieval system