KEGG   Plasmodium vivax: PVX_118495Help
Entry
PVX_118495        CDS       T01073                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pvx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pvx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pvx00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pvx00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pvx00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 248 aa AA seqDB search
MTRKYFVSANWKCNGTQESVKALAASFNELDFDPAKLDVVVFPVSVHYELAKSLLKPKFH
TGIQNVSKFGSGSYTGEISAEIAKDLNIEYVIIGHFERRKYFNETDEDVKDKLQQCLKNN
LKVVVCFGESLEQREKNQTIDVITKQVNSFVHLIDNFDNVVLAYEPIWAIGTGKTATPEQ
AQEVHKEIRNIVKEKCGEKNANQIRILYGGSVNTDNCASLIKQEDIDGFLVGNASLKSSF
VEIIKSAM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaaaatacttcgtatcagccaactggaaatgcaatggaacccaggagagcgta
aaggccctggcggcgagctttaatgagttggacttcgaccccgccaagctggacgtggtc
gttttccccgtgagcgtgcactacgaactcgcgaagagcctgctgaagccaaagttccac
acgggcatacaaaatgtgtccaagttcggcagtgggtcctacacaggagaaatcagcgcg
gaaattgcaaaagacctgaacatagaatatgtaatcatcggacattttgaaagaagaaaa
tacttcaacgaaacggatgaagatgtaaaggataaattgcaacagtgtctaaaaaataac
ctaaaagttgttgtttgttttggtgagtccctagaacagagggaaaaaaatcaaaccatc
gatgtgataacaaagcaagttaacagttttgttcatttaattgataactttgataatgtc
gttttggcatatgaacccatttgggccattgggacgggaaaaactgccacgcctgaacaa
gcacaagaggttcataaagaaatcagaaatattgtgaaagaaaaatgtggagaaaaaaat
gctaaccagattagaattctctatgggggtagtgttaacaccgacaattgtgcttccctc
attaagcaggaagatattgatgggttcctcgttggcaatgcttctttgaaatcatccttt
gttgaaattattaagagtgctatgtaa

DBGET integrated database retrieval system