KEGG   Plasmodium vivax: PVX_118495Help
Entry
PVX_118495        CDS       T01073                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvx  Plasmodium vivax
Pathway
pvx00010  Glycolysis / Gluconeogenesis
pvx00051  Fructose and mannose metabolism
pvx00562  Inositol phosphate metabolism
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
pvx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_118495
   00051 Fructose and mannose metabolism
    PVX_118495
   00562 Inositol phosphate metabolism
    PVX_118495
Enzymes [BR:pvx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PVX_118495
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PVX_118495
  Exosomal proteins of bladder cancer cells
   PVX_118495
  Exosomal proteins of melanoma cells
   PVX_118495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC AP_endonuc_2 AAA
Motif
Other DBs
NCBI-GeneID: 5475290
NCBI-ProteinID: XP_001615992
UniProt: A5K411
Position
12
AA seq 248 aa AA seqDB search
MTRKYFVSANWKCNGTQESVKALAASFNELDFDPAKLDVVVFPVSVHYELAKSLLKPKFH
TGIQNVSKFGSGSYTGEISAEIAKDLNIEYVIIGHFERRKYFNETDEDVKDKLQQCLKNN
LKVVVCFGESLEQREKNQTIDVITKQVNSFVHLIDNFDNVVLAYEPIWAIGTGKTATPEQ
AQEVHKEIRNIVKEKCGEKNANQIRILYGGSVNTDNCASLIKQEDIDGFLVGNASLKSSF
VEIIKSAM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaaaatacttcgtatcagccaactggaaatgcaatggaacccaggagagcgta
aaggccctggcggcgagctttaatgagttggacttcgaccccgccaagctggacgtggtc
gttttccccgtgagcgtgcactacgaactcgcgaagagcctgctgaagccaaagttccac
acgggcatacaaaatgtgtccaagttcggcagtgggtcctacacaggagaaatcagcgcg
gaaattgcaaaagacctgaacatagaatatgtaatcatcggacattttgaaagaagaaaa
tacttcaacgaaacggatgaagatgtaaaggataaattgcaacagtgtctaaaaaataac
ctaaaagttgttgtttgttttggtgagtccctagaacagagggaaaaaaatcaaaccatc
gatgtgataacaaagcaagttaacagttttgttcatttaattgataactttgataatgtc
gttttggcatatgaacccatttgggccattgggacgggaaaaactgccacgcctgaacaa
gcacaagaggttcataaagaaatcagaaatattgtgaaagaaaaatgtggagaaaaaaat
gctaaccagattagaattctctatgggggtagtgttaacaccgacaattgtgcttccctc
attaagcaggaagatattgatgggttcctcgttggcaatgcttctttgaaatcatccttt
gttgaaattattaagagtgctatgtaa

DBGET integrated database retrieval system