KEGG   Plasmodium vivax: PVX_122420Help
Entry
PVX_122420        CDS       T01073                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pvx  Plasmodium vivax
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PVX_122420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 154 aa AA seqDB search
MNVARNKKNNLIDDELPNDFVLPKGDKVKGEKLFKKHCKQCHSIAPDNTQSNSGFTSWGP
SLFNVYNRTAGMSRGNSPFQVSPDMYASGIIWNDLNLMKYMRNPKDFVEANIGMNFKGIS
NFQDRVDIVHYLKTLTYDDPHGREIVEKFSKKKK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagccaggaataaaaagaacaacctgatagatgacgaactaccaaatgatttt
gtgctacccaagggagacaaagtaaaaggggagaagctattcaagaagcactgtaagcaa
tgtcactccatagcccccgacaacacacaatccaattcggggttcacgagttggggtccc
tccttatttaatgtttataacagaacggctggaatgagcagaggcaattcgccttttcaa
gtatcacctgatatgtacgcgtcaggcattatatggaatgacttaaatttaatgaagtac
atgaggaaccccaaagattttgtagaagcaaacattggtatgaactttaaaggaatttca
aattttcaagatagggttgacatcgttcactatttaaaaacccttacgtatgatgaccca
catgggagagaaattgtggaaaaattttccaaaaaaaaaaaataa

DBGET integrated database retrieval system