KEGG   Plasmodium vivax: PVX_122850Help
Entry
PVX_122850        CDS       T01073                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pvx  Plasmodium vivax
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_122850
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PVX_122850
  Amino acid metabolism
   00310 Lysine degradation
    PVX_122850
Enzymes [BR:pvx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PVX_122850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 415 aa AA seqDB search
MTQNLVLRLNKPLFYNAKGISRILNLECKQCVNCHSTFKRCFSIDTIKVPRLGDSITEGT
ISEWKKKVGDYVKVDETITIIDTDKVSVDINSKSSGALSKIFAEAGDIVLVDAPLCEIDT
SVEPPAHISEVKEEIAQSKTVQASEQNGSEKEEGKKDQNSAHKESERKVSEANNTRVLYE
AVSERTETRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKVIVLRSELKDIFQKKYG
CKLGFVSLFMHASTLALKKMPQVNAYIDNDEIVYRNYVDISVAVATPNGLTVPIIRDCQN
KKLSELELALSELATKARNNKLSLDDFTGGTFTISNGGVFGSMLSTPIVNMPQSAILGMH
TIKDRAVVVNNEIVIRPIMYLALTYDHRLLDGRDAVQFLSAIKDYIENPSLMLID
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaccttgtgcttcgattgaacaaacccctgttttataacgcgaaagggatt
agcaggatcctcaacctggagtgcaagcaatgcgtgaactgtcattccacatttaaaaga
tgcttctccatagacacgataaaagtacccaggcttggagattccattacggaaggcacc
atcagcgaatggaagaaaaaagtgggtgattatgttaaggtggatgaaacgataacgatt
atcgacacggacaaagtaagcgtcgacataaactccaaatccagtggggcgctttcaaaa
atatttgcagaagcgggagacatcgttttggtcgatgcgcccctgtgcgaaatagacact
tcagtggagccacctgctcacatatcagaagtgaaggaagaaatagcacaaagcaaaact
gtgcaagcgagtgaacaaaatggaagcgaaaaggaggaaggtaaaaaggaccaaaatagc
gcgcacaaagaaagcgaaagaaaagtaagtgaagcgaataacacaagagtgctatacgaa
gccgtcagtgaaagaaccgaaacgagagtgcgcatgttgccaataagaaaacgaattgcc
gaaaggctcaaagaatcgcaaaacacgtgcgcgttgctaaccacatttaacgaatgcgac
atgagcaaagtgatagtcctacgcagtgagttaaaagacatctttcaaaagaagtatgga
tgcaaattagggttcgtatccctcttcatgcatgcgtcaaccttagctctaaaaaaaatg
ccacaagtaaatgcatacatagataacgatgagattgtgtaccgaaattatgttgacata
tccgtagcagtggccacacccaacggattaacagttcctatcattcgagattgccaaaat
aaaaaactatcagaacttgaactggctctatccgagttggctaccaaagcgaggaacaac
aaattgtcgttagacgatttcacgggtggtacttttaccatttcgaatggaggcgttttt
ggcagcatgttaagcacacccattgtgaacatgccgcagtcggctatactaggtatgcac
acaataaaagacagagccgtagtggtaaacaatgaaattgtcattaggcctatcatgtat
ttggccctaacttatgaccacagattgctcgatggaagagacgccgtgcagtttttaagc
gcaataaaggactatatagaaaacccgagcctcatgctgattgattga

DBGET integrated database retrieval system