KEGG   Plasmodium vivax: PVX_122930Help
Entry
PVX_122930        CDS       T01073                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
pvx  Plasmodium vivax
Brite
Exosome [BR:pvx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PVX_122930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagctcaaaaatcccaagctgcaaagaaaactgcaggaaaaacc
ttgggaccaaggcataagagaaaaagaagaacagagtcattttcactttacatttttaaa
gttttaaaacaagtgcatccagaaactggtgtgacgaaaaaaagcatgaatattatgaat
tctttcattaatgatatatttgacagattagttaccgaagcaactagactaattcgttat
aataaaaagagaaccttgtcatcacgtgaaattcagactgccgttaggttacttttgcct
ggagaattgtcaaaacacgctgtctctgaaggaaccaaggccgtaacaaagtacaccacc
agtggtgcatag

DBGET integrated database retrieval system