KEGG   Plasmodium vivax: PVX_123230Help
Entry
PVX_123230        CDS       T01073                                 

Definition
hydroxymethylpterin pyrophosphokinase-dihydropteroate synthetase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pvx  Plasmodium vivax
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pvx00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 717 aa AA seqDB search
MEDSNTGGTTPRNIAVLNFGTNDKKNCVTILETALYLTEKYLGKIINSSYIYETVPEYIV
LDEENKIGEVTEGEPPRDISWIGDLIPTVENSRYEESEDLIYECKELEVFLKNEKINESI
IREVSVEDYENEARRIIKRNDEIMKKNLEQSKDKYYTSYFFNLTVVVRTFVEDPLAMLVI
LKYIEQIMKRRESKKGQGEIFQNRMIDIDILFFNNYTIFEKSISLKGEDIYKIITKYIHI
NHTSDQNRLDIIQNLGDKIEFLCIPHVYTKYRYSILLCLNDIIPEYKHSTFEEAIRSTYN
SYVESFEEKYHINIRKNNKRLYVLKDKVSYLKERTHIVGILNVNYDSFSDGGLFVDPVKA
VERMFEMASDGASVIDIGGESSAPYVVPNPSVTERDLVMPVLKLFKEEWHKLECEVGGGA
VCCAAASDARKNAQSSLQGKLQKVRDAKPIISIDTVNYDLFKECVEGELVDILNDISACT
HNPEIIKLLRRKNKFYSVVLMHKRGNPHTMDKLTNYDDLISDIKRYLEDRLHFLVLNGVP
RYRVLFDVGLGFAKKHDQSIKLLQHIHVYDEYPLFLGYSRKRFIVHCMGKGGAAIGECRL
MSGEAKLTNGEGKLTNGEAKLTNGEGKLTNGDAKLTNGDSKLTNGEAKLTNGDPSQLWRF
KMSHMRQDKDQLLYQKNICGGLAIASYSFYKKVDLIRVHDVLETKAVLDVLTRIHQP
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaggattcaaacacggggggcactaccccaaggaatatcgccgttttaaacttcgga
acgaatgacaaaaagaactgcgtaacgattttagaaacggcgctctatctgacggagaag
taccttggcaaaatcatcaacagttcgtacatttacgaaaccgtcccggagtacatcgtc
ctggatgaagaaaacaaaattggagaggtgacggagggggagcccccgagggacatctct
tggataggcgatttgatcccaactgtggaaaactccagatacgaagaaagtgaagattta
atttatgagtgcaaagagttggaggtgtttttaaaaaatgaaaagataaacgaaagcatt
attagggaagtcagcgtagaggattacgaaaatgaggcaagaaggataatcaaacggaat
gacgaaataatgaagaaaaatttagaacagtcgaaagataaatactacaccagttatttt
tttaacttaacggttgtagttaggacctttgttgaagaccccctcgccatgctcgtaatt
ttaaagtacattgagcaaatcatgaaaagaagggaaagcaaaaagggtcagggagaaata
tttcaaaatcgcatgatagacattgacattttattttttaacaactacacaatttttgaa
aagagcatatctttaaaaggggaagatatttataaaatcatcacaaagtatattcacata
aaccacacaagtgatcagaaccgtctagatattatccaaaatttgggagacaaaatagaa
ttcttatgtatccctcatgtgtacacgaaatacaggtatagtatcctcctctgcttaaat
gatatcattccagagtataagcacagcacatttgaggaagccattcgctcaacttataac
agttatgttgaaagttttgaggagaagtatcacattaatattaggaagaataataagagg
ctatacgtattgaaagataaagtgtcatatttaaaagaaagaactcatattgtgggcatt
ttgaatgttaactatgattccttttcagatggcggtttatttgtcgatcctgtgaaagct
gtggagaggatgttcgaaatggcaagtgatggggcgagcgtgattgacatcgggggggaa
tcgtccgccccttatgtggtccccaatccgagcgtcactgaacgggatttggtcatgcct
gttttgaagctctttaaggaggagtggcataagttggagtgtgaggttggcggtggtgcc
gtgtgctgcgctgcagcaagtgatgccaggaaaaacgcgcagagctccctacaggggaaa
ctacaaaaagtgagggacgcaaaaccgatcataagcatcgacacggtcaattatgatctc
ttcaaggagtgcgtggaaggcgagttggtggacatcctaaacgatatcagcgcgtgcacg
cacaacccagagattataaaattgttgaggaggaaaaacaagttctatagcgtcgtttta
atgcacaagaggggaaatccacacaccatggataagttaacaaattacgatgaccttata
agtgacattaaaaggtatttagaagatcggctacattttctcgttctaaatggggtacca
cgctaccgagttctctttgatgtcggcctggggtttgccaaaaagcacgaccagtctatt
aagctgttgcagcatattcacgtttacgatgagtacccgctgtttcttggctactcgagg
aagcgctttattgtccactgcatggggaagggtggcgcggccatcggggagtgcagactg
atgagcggggaggccaaactgaccaacggggagggtaaactgacgaatggggaggccaaa
ctgaccaacggggagggtaaactgacgaatggtgacgccaaactgactaacggtgactcc
aaactgactaacggggaggccaagctgaccaacggagacccatcacaactgtggaggttc
aaaatgagccacatgcgtcaagacaaagatcagcttttgtaccagaaaaatatttgcggc
gggctagccattgcttcctacagcttttacaaaaaggtggaccttatcagagttcacgac
gtgttagaaacgaaggccgttctggatgtgctcacaaggatacatcaaccttag

DBGET integrated database retrieval system