KEGG   Plasmodium vivax: PVX_123230Help
Entry
PVX_123230        CDS       T01073                                 

Definition
hydroxymethylpterin pyrophosphokinase-dihydropteroate synthetase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pvx  Plasmodium vivax
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVX_123230
Enzymes [BR:pvx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PVX_123230
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PVX_123230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 717 aa AA seqDB search
MEDSNTGGTTPRNIAVLNFGTNDKKNCVTILETALYLTEKYLGKIINSSYIYETVPEYIV
LDEENKIGEVTEGEPPRDISWIGDLIPTVENSRYEESEDLIYECKELEVFLKNEKINESI
IREVSVEDYENEARRIIKRNDEIMKKNLEQSKDKYYTSYFFNLTVVVRTFVEDPLAMLVI
LKYIEQIMKRRESKKGQGEIFQNRMIDIDILFFNNYTIFEKSISLKGEDIYKIITKYIHI
NHTSDQNRLDIIQNLGDKIEFLCIPHVYTKYRYSILLCLNDIIPEYKHSTFEEAIRSTYN
SYVESFEEKYHINIRKNNKRLYVLKDKVSYLKERTHIVGILNVNYDSFSDGGLFVDPVKA
VERMFEMASDGASVIDIGGESSAPYVVPNPSVTERDLVMPVLKLFKEEWHKLECEVGGGA
VCCAAASDARKNAQSSLQGKLQKVRDAKPIISIDTVNYDLFKECVEGELVDILNDISACT
HNPEIIKLLRRKNKFYSVVLMHKRGNPHTMDKLTNYDDLISDIKRYLEDRLHFLVLNGVP
RYRVLFDVGLGFAKKHDQSIKLLQHIHVYDEYPLFLGYSRKRFIVHCMGKGGAAIGECRL
MSGEAKLTNGEGKLTNGEAKLTNGEGKLTNGDAKLTNGDSKLTNGEAKLTNGDPSQLWRF
KMSHMRQDKDQLLYQKNICGGLAIASYSFYKKVDLIRVHDVLETKAVLDVLTRIHQP
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaggattcaaacacggggggcactaccccaaggaatatcgccgttttaaacttcgga
acgaatgacaaaaagaactgcgtaacgattttagaaacggcgctctatctgacggagaag
taccttggcaaaatcatcaacagttcgtacatttacgaaaccgtcccggagtacatcgtc
ctggatgaagaaaacaaaattggagaggtgacggagggggagcccccgagggacatctct
tggataggcgatttgatcccaactgtggaaaactccagatacgaagaaagtgaagattta
atttatgagtgcaaagagttggaggtgtttttaaaaaatgaaaagataaacgaaagcatt
attagggaagtcagcgtagaggattacgaaaatgaggcaagaaggataatcaaacggaat
gacgaaataatgaagaaaaatttagaacagtcgaaagataaatactacaccagttatttt
tttaacttaacggttgtagttaggacctttgttgaagaccccctcgccatgctcgtaatt
ttaaagtacattgagcaaatcatgaaaagaagggaaagcaaaaagggtcagggagaaata
tttcaaaatcgcatgatagacattgacattttattttttaacaactacacaatttttgaa
aagagcatatctttaaaaggggaagatatttataaaatcatcacaaagtatattcacata
aaccacacaagtgatcagaaccgtctagatattatccaaaatttgggagacaaaatagaa
ttcttatgtatccctcatgtgtacacgaaatacaggtatagtatcctcctctgcttaaat
gatatcattccagagtataagcacagcacatttgaggaagccattcgctcaacttataac
agttatgttgaaagttttgaggagaagtatcacattaatattaggaagaataataagagg
ctatacgtattgaaagataaagtgtcatatttaaaagaaagaactcatattgtgggcatt
ttgaatgttaactatgattccttttcagatggcggtttatttgtcgatcctgtgaaagct
gtggagaggatgttcgaaatggcaagtgatggggcgagcgtgattgacatcgggggggaa
tcgtccgccccttatgtggtccccaatccgagcgtcactgaacgggatttggtcatgcct
gttttgaagctctttaaggaggagtggcataagttggagtgtgaggttggcggtggtgcc
gtgtgctgcgctgcagcaagtgatgccaggaaaaacgcgcagagctccctacaggggaaa
ctacaaaaagtgagggacgcaaaaccgatcataagcatcgacacggtcaattatgatctc
ttcaaggagtgcgtggaaggcgagttggtggacatcctaaacgatatcagcgcgtgcacg
cacaacccagagattataaaattgttgaggaggaaaaacaagttctatagcgtcgtttta
atgcacaagaggggaaatccacacaccatggataagttaacaaattacgatgaccttata
agtgacattaaaaggtatttagaagatcggctacattttctcgttctaaatggggtacca
cgctaccgagttctctttgatgtcggcctggggtttgccaaaaagcacgaccagtctatt
aagctgttgcagcatattcacgtttacgatgagtacccgctgtttcttggctactcgagg
aagcgctttattgtccactgcatggggaagggtggcgcggccatcggggagtgcagactg
atgagcggggaggccaaactgaccaacggggagggtaaactgacgaatggggaggccaaa
ctgaccaacggggagggtaaactgacgaatggtgacgccaaactgactaacggtgactcc
aaactgactaacggggaggccaagctgaccaacggagacccatcacaactgtggaggttc
aaaatgagccacatgcgtcaagacaaagatcagcttttgtaccagaaaaatatttgcggc
gggctagccattgcttcctacagcttttacaaaaaggtggaccttatcagagttcacgac
gtgttagaaacgaaggccgttctggatgtgctcacaaggatacatcaaccttag

  All links  
No link information was found.   
DBGET integrated database retrieval system