KEGG   Plasmodium vivax: PVX_123620Help
Entry
PVX_123620        CDS       T01073                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pvx  Plasmodium vivax
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PVX_123620
Exosome [BR:pvx04147]
 Exosomal proteins
  Proteins found in most exosomes
   PVX_123620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 1935 aa AA seqDB search
MNPNNPLSVAVADSLSAYDIQNESFRLGNVSIEGDKFICVKENVNENTQVVVINLQNKIS
TRKYMKAESVIIHPNDPILALRGTIKNVNTIFLQVFNIETKEKICSLNLNEYMNYWKWIN
NDTIAIVCERNVYHWNIDIHNSKRHKENYTLTKVFEKAQVFIDNNSQILYYATDKDMKWC
ILCGISTQDQGKSIDGHMQLYSCDKKLHQTIEGFIGCFGSFIFDNWDIKPLFCFVEKKKN
STVSRLHLMDIYTNKTEAGTMPYKIVKEINLINEHISDFPIYISLNTLQGVIYIVTKCSY
VYIFDEGTLTQLVKEKISEDNIFTCCDSKNGEGIYAVNKKGKIYYITINYVNLINHIKLS
NFDGRDKIIKNLCVKYGYPGCDYISAYKKCINEMDFKKASKIICLLKNTKTYEDYSSSVA
EAVLIMTRKNVDIRIIPPLRTQQVLNSFKSMKNASGQLSPLLLYFSVLLEYDKLNTYESV
ELVKPVVLQKKKEYLEKWIKDDKLTCSEELGDLVKVLDLRLALNIYLRCGAHNKIISTYC
LLNMFNNVLSYLNNFKQVSFDFVSIFIVIVNYESQCGNEKDASSPMADMSTSSKNEAMDF
FNDGSNSTNDSRQGKGSNSEVAVQYVKFLCENNIPFDINNIVDYLLSKKKLQEATSILLD
FLKDNKPEHKNLQTKLFEFNLYNNVQVAETLFQMDIFTYYDKNRIAYLCEEKGLFQRALE
NYTNLNDIKRVITKSSCFQKSTNSSQMDGSLPNRGISIDWIKKYFSTLSDSVCQDILFDF
MKGNKINMEVVISICVQYYNKIGIKKIINKFEENKNYEGIFYFVSSILTHLPNLTNKATD
HLSYGSMNDETSSILLASDIGSQYNNAENPSSLKIEDVHFIMFKYIEACVKINNIQELDR
ICKDKNAKYNPEQIKNFLKDCKLSDPRPLIYVCDIHNYIEELAEYLYKNSLLKYIEVYVI
KVNPNNAHKVIGVLLDLDASEDFLLNLLNNIKNISNIGNLIEIAEKRNRLKLLLPWLESR
SNEGYENIELHNALAKIYIDLNKDPENFLKNNNFYDKKLIGKYCEDLDPHLAYTVYEKSN
GECDEELINITSKNGLFKLQAKYLVSRQSMELWKRVLDESNKYRKNVIDQVIGSTLIESN
NAEEITVTVKAFIEKKLSSELIELLEKIVLHNSEFSDNKNLQNLLILTAIKSDSKKVMEY
INRLDSFSGPQIASVAYDYKLREEAFVIYKKFNCYTSAISVLLDKILQVNNKGAYPNEFS
RASSSVYNESDEYVKQLGEGGSYGYQERADNLFGGSNEVSGALAESDSLNAQETILDAKS
YEDDLNRAIEYAQKCNHNDVWFILGKAQLKINKIIDAIDSFVKSNNPEAYKEVIAKCKEN
NFYEHLITYLNTLRDQNLLKDVLVDSELLYAYAKLKKTTEMTKFIGSTNSANLQLIGDRL
FKEQEYEVAKILYSNIPNNQKLTFCYLKLKEYSLAIEAAKKAKSLKTWKEVNFICVKYKQ
LKHAHTAGLQLIMHADHLDEIINIYEKKKYINELMSLLENGLNSERAHVGIYTELGILYA
KYKPEKLMEFIRNYSNKMNTRKLIDVCQNEYLLKEAVYLYISYDEYNLAVDTIIKHSPTA
YTPDTFMQVIHKVTNSDIIHKVIDFYIEEHPLNLYNLLKILENKIDNNRLVQTLKKSNNL
PLIQKYLEDIQGQNITAVNETLNEIYLQNDDYISLRNSIDDYDNFNQTNLINKLENHKLS
EMRRIAALLYKKNKKYKEAINLSKKEEQYKDAIEIARVSKNNSYVEDLINFFIEIKNKEA
LCACLIVCYDILKPDYILEIVWTSGFKDQAMLYFIQVISDYTSQIDAMKKQIEDMQKEKK
MNKSAPNDFAANDFAANDFAGNDFAPNSMSGQFTYSLNNHLSIMPPQNSYMSSSSQYDKF
DKFDKYDMFNNNAHF
NT seq 5808 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaacaaccccttatctgtggcggtggcagatagtctgtccgcgtatgacatc
cagaatgagtcgtttcgtctaggcaatgtatccatcgaaggagacaaatttatatgcgta
aaagaaaatgtgaacgagaatacgcaagtggtggttataaatttgcaaaataagataagc
acgcggaagtatatgaaagcagagagcgtcattattcaccccaatgaccccatattagca
ttgagaggcacaataaaaaatgtcaacacgatatttttacaagtttttaacatagaaacg
aaggaaaaaatatgctctttaaacctaaatgagtacatgaattattggaagtggataaat
aatgacaccattgccattgtgtgtgagaggaatgtataccactggaacatagacatccac
aatagcaagaggcataaggagaattacaccttgacgaaggttttcgagaaggcgcaagtg
ttcattgataataattctcaaattttatactacgctacagataaggacatgaaatggtgc
attttgtgtggcatatctacgcaggatcaagggaaaagcatcgatgggcacatgcaactt
tactcgtgtgataagaagttgcaccaaacgattgaagggtttatcggatgttttggatct
ttcatatttgacaactgggatataaagccgctcttctgtttcgtcgaaaagaagaaaaat
tcaaccgtgtcgagactccacttgatggatatatacaccaacaaaacggaggcgggcacc
atgccatacaaaattgtgaaggaaattaacctgataaatgaacacattagtgatttccca
atttacatcagcctgaacactctgcaaggggtgatatacatcgtcaccaagtgcagctat
gtgtacatatttgatgaaggcacgctaacacaacttgtgaaggagaaaatcagcgaagat
aacattttcacctgctgtgatagtaaaaacggcgaaggaatatacgcggtgaataagaaa
ggaaaaatttactacatcactattaactacgtcaacttgataaaccacatcaaattgtct
aactttgatggtagggataaaattataaaaaatttgtgtgtaaaatatgggtacccaggg
tgcgactatataagtgcctacaaaaaatgcattaacgaaatggattttaagaaggcctcc
aaaattatatgcctactgaagaacaccaaaacgtatgaggactactccagctcagttgcc
gaggctgtcttaattatgaccaggaaaaatgtagacattagaattatcccccctttgaga
acacagcaagtgttgaacagcttcaaatcgatgaagaacgcatctgggcagctctccccg
ctgcttctttacttttcagtgctgctcgagtatgacaagttgaatacatacgaatcggtc
gagctggtaaaacccgtggttttgcaaaaaaagaaggagtacctagaaaaatggataaag
gatgataagttaacctgctcggaagaattgggagacctagtcaaagtgttagacctgcgt
ctagcgttgaatatttacctgcggtgtggggcgcacaataaaataatttccacgtactgc
ctcctcaacatgtttaataatgtgctcagctatttgaacaattttaagcaggtctccttc
gacttcgtcagcatattcatagtcatcgtgaattacgaatctcagtgtggtaacgaaaag
gatgcgagttcccccatggccgatatgagtacctcctcgaaaaacgaagcgatggatttc
ttcaacgacggaagtaacagtacaaacgatagcaggcagggaaaaggtagcaacagcgaa
gtggccgtgcagtacgtaaaattcctgtgcgaaaataacatcccttttgatatcaacaat
attgttgactacctgctgagtaagaagaagttacaagaagccacttccattctgctggac
ttcctaaaggacaacaaaccggagcataagaatttgcaaaccaagctgtttgaatttaac
ctttacaacaatgtgcaagtagcagaaacgttgttccaaatggatatctttacctactat
gataagaacagaatagcctatttgtgtgaagagaagggactatttcagagggccctagaa
aactacaccaatttgaatgacataaaaagggtgatcacaaaatcgtcttgctttcaaaag
agcacaaatagcagtcagatggacggctctctccccaacagggggatctccatcgactgg
attaagaagtacttttccacgttaagcgattcggtgtgtcaagatattctcttcgatttc
atgaaggggaacaaaataaatatggaggtcgtcatttcgatctgcgttcagtactataac
aaaataggcatcaagaaaattatcaacaaatttgaggagaataaaaactacgaaggaatt
ttctacttcgttagttcgattctgacccatctgccaaacttaaccaacaaggcgacggac
cacctatcctatggaagcatgaacgatgagacgtcgtccattctgctggcatctgacatc
gggtcgcagtacaacaacgcggaaaatccctccagcctgaaaatcgaagatgttcatttt
atcatgtttaaatatattgaggcgtgtgtgaagataaacaacatccaagagctagaccga
atttgtaaagacaaaaatgcaaagtataatccggagcaaattaaaaacttcttaaaggac
tgcaaactgtctgacccgcgtccgctcatatacgtgtgtgacatacataactatattgaa
gagctcgcggaatatttatataaaaatagcttgttgaaatatatagaagtgtacgtcatt
aaggtgaatccgaacaatgcccacaaggtgatcggcgtgctcctagacctggacgcctcg
gaagacttcctcctcaacctgttgaacaatataaaaaatatttccaatatagggaaccta
atcgaaatagcggaaaagaggaataggctaaaactgctgctaccttggctggaaagcaga
tccaatgaaggatatgaaaatatcgaactgcataatgcactggccaaaatatacatcgac
ttgaataaagatcctgagaatttcctaaagaataacaatttttatgacaaaaaattgata
gggaaatattgcgaagatctggaccctcacttagcctatactgtgtatgagaaatcgaac
ggagagtgcgacgaggagttgatcaacataaccagcaaaaatggcctattcaaactgcaa
gccaaatatttagtgtctagacaatccatggaattgtggaaaagagttctggacgaatct
aacaaatacaggaaaaacgtaatcgatcaggtcatcggctcgacgctgatcgaatcgaat
aacgcagaagaaattaccgtaacggttaaagcctttattgagaaaaagctgagcagcgaa
ttaattgagttgctagaaaaaatcgttttgcataacagcgaatttagtgataataagaat
ttgcaaaacttgctaatcttgactgccatcaaatcggattcgaaaaaagtgatggagtat
atcaaccgacttgacagcttttctgggccacaaattgcctccgttgcgtatgactataag
ttgcgggaggaggcctttgttatttataaaaagttcaattgctacacgtcagctatttcg
gtgttgttggataagattttgcaagtgaataataaaggcgcctacccaaatgaattttcg
cgagcgagttcgtcggtctacaacgagagcgacgagtatgtgaagcagctgggagaggga
ggaagctacggctatcaagagcgggcggacaacttgttcggcggcagtaacgaggtgagc
ggcgcgcttgcagagtctgattcgctcaacgcgcaggaaactatcctagacgcgaagagc
tacgaagatgacctaaacagagccatcgaatacgcacaaaagtgcaaccacaacgatgtg
tggttcatcctaggaaaggcgcaactgaagataaacaaaattattgacgccattgacagc
ttcgtcaaatcgaacaacccggaagcgtacaaagaagttatagcaaaatgcaaggagaat
aacttttacgagcatttaattacctatttgaacaccctgagggatcagaatttgctaaag
gacgtgttggtagattcggagctgctgtatgcctacgcgaaattgaaaaaaaccacagaa
atgactaaatttattggctccacgaattcagccaacttgcagctaataggggatagactg
ttcaaagagcaagagtacgaagtggccaaaatattgtacagcaacataccgaacaatcag
aagctgaccttctgctatctgaagctgaaggagtactcgctagctatagaggcagccaaa
aaggcgaagagtctcaaaacgtggaaagaagtaaacttcatttgtgttaagtacaagcag
ctgaagcatgcgcacacggcggggctccaattaatcatgcacgcggatcacctagacgaa
attatcaacatttatgaaaaaaaaaaatacataaacgagttaatgagcctactggagaac
ggactaaacagtgaaagggcacacgtgggaatctacacagaattgggaatcctctacgcc
aagtacaaaccggagaagctaatggagttcataagaaactactccaacaaaatgaacaca
aggaaactaatcgatgtttgccaaaatgaatacctattaaaagaagctgtttatttgtac
atatcgtacgatgagtacaacctagcggtggacaccatcataaagcactcccccactgcc
tacacaccagacaccttcatgcaggtgattcacaaagtgactaacagtgacatcatacac
aaagtaatcgatttctatatagaagagcaccctttaaatttgtataatttgttaaaaatt
ttggaaaacaaaattgataacaatcggttagtacaaacattgaagaagtccaacaattta
cccctcatacaaaaatatctggaagatatccaagggcaaaatataactgctgtaaatgaa
acgctaaacgaaatttatttacaaaatgatgattacatcagcttgaggaactcaattgat
gattatgataattttaaccaaacgaatttaatcaacaaattggaaaaccacaagctttca
gaaatgagaagaatcgcagctctgctttataagaaaaataaaaaatataaagaagctatt
aatctttccaagaaagaggaacaatataaggacgcaattgaaattgcaagagtgtcaaag
aataattcctacgtggaagatttaataaattttttcatcgaaattaaaaataaagaagct
ttgtgtgcttgcctgatcgtttgctatgatatactcaagccggactatattttagaaatt
gtctggaccagcggatttaaggaccaagccatgttgtacttcattcaggttatcagcgat
tacaccagtcagatcgacgccatgaagaaacaaatcgaagacatgcagaaggagaagaag
atgaataaatctgcccccaacgattttgccgccaacgattttgcggctaacgattttgcg
ggcaacgactttgcgccgaactccatgtctggccagttcacctactcgctcaacaaccac
ctgtccatcatgcctccccagaatagctacatgtccagcagttcccagtacgacaagttt
gacaagtttgacaagtacgacatgtttaacaataatgcgcacttttga

DBGET integrated database retrieval system