KEGG   Plasmodium vivax: PVX_123830Help
Entry
PVX_123830        CDS       T01073                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pvx  Plasmodium vivax
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVX_123830
Enzymes [BR:pvx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PVX_123830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 423 aa AA seqDB search
MFKRGDLHEGKHRGVDSVGTYEQRGCSSSEAPVKDTQLVASSRSEDQREGRQYVLSTSPM
NTNLGLGLGLLGAQNGAEENGGGWNNCGDGDGHFACKSHHEYGFVNKGGELRYNGSSLSG
KIERMADGGTTNAGVLSRLSEEAGLGKARQDDSGSSTETPPACATLMEEKKGAVNGVRRK
VIKRVEKEGQRGRSGDESGSDSFGGDPPGARRNATGRSKETQMEAISKSINHILSSSNVP
PKDILKRTSKRFTDTFLYLTKGYHMNVGKVIKKSLYKRKYKNDSRIKISGIHIYSLCKHH
LLPFEGECSIEYVPNRYVMGLSKFSRVINIFARRLQLQEDLTNDICNALRKYLKPKYIHV
NVVARHLCINMRGVREHDATTVTNAYYGVDEGARAGQKVDFARASQAGDGNELPREEVAL
VRR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgaggggacctccatgaggggaagcaccgtggcgtagatagcgttggtaca
tacgagcagagaggttgctcttcgagtgaagcaccggttaaggacacccagttggtagct
tcaagtcggagtgaagaccagcgagagggccgccaatacgtattgagtactagccctatg
aacaccaatttagggttagggttagggttgttgggggcccagaatggtgctgaagagaat
ggcggagggtggaataactgcggagatggggatggccatttcgcttgcaaaagtcaccac
gagtatggctttgtcaacaagggtggcgaattacgttataatggaagtagcctttcgggg
aagatcgaaaggatggcggatggtgggacgaccaatgcaggggtactaagccgtcttagt
gaagaggcgggtttggggaaggcccgccaagacgactcggggagctccacggagaccccc
cccgcttgtgccaccttgatggaggagaaaaagggcgcagttaatggggtgcggaggaag
gtgatcaaaagggtggagaaggagggccagcgggggagaagcggtgatgaaagcgggagt
gactcctttgggggagacccccccggcgcgcggaggaacgcgacgggtcgctcgaaggag
actcaaatggaagccatcagcaaaagcattaaccacattttaagctcctccaatgtgccc
ccaaaagatatactcaaaaggacaagcaaaagatttacagacacttttctttatttaaca
aaagggtaccatatgaacgtagggaaagttataaaaaagagtttgtataagagaaagtac
aaaaatgattcgcgcataaaaataagtggcattcatatttactccctctgcaaacatcat
ctgttgccattcgaaggggagtgctccatcgagtatgtgcccaacagatatgttatgggt
ctttctaagttctccagagttattaacatttttgcaaggaggctacagctgcaggaggac
ttaaccaatgacatttgcaacgcgctcaggaagtatttgaagccgaaatatatccacgtg
aatgttgtggccaggcacttgtgcattaacatgcgcggggtgagggaacacgacgcgact
accgtgacgaatgcgtactacggggtggacgagggcgcgcgcgcggggcagaaagtagat
tttgcgcgtgcgagtcaggcgggggatgggaacgaactgcctcgcgaggaggtggccctc
gtgcgaaggtga

DBGET integrated database retrieval system