KEGG   Pectobacterium wasabiae: Pecwa_0035Help
Entry
Pecwa_0035        CDS       T01106                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0035
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Pecwa_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
38368..39765
Genome map
AA seq 465 aa AA seqDB search
MHDHLQNDFRFPANFWWGSASSAPQTEGESLSYGKSATVWDEWFATQPGRFHQQVGPADT
STFYQHWREDIALLKALNHNTFRTSISWARLIPDGVGEPNPQAVAFYNQIIDEMLAQGIT
PFINLFHFDMPMVMQRLGGWENRAVVVAYAGYAATCFRLFGDRVKHWFTFNEPVVPVEGG
YLYDFHYPNVVDFKRAATVAYHTMLAHALAVKAYREQSQDGEIGIILNLTPSYPRSQHPA
DVKAANIADLMFNRSFLDPALKGEYPQELVDLLHRYGQLPSCQPDDRALLADGVVDLLGI
NYYQPRRIQCRDSLVNPDSPFMPEWFFSSYEMPGRKMNPYRGWEIYEPGIYDILTNLRVN
YGNPRCFISENGMGVESEQRFDANGQIQDDYRIDFVREHLKYVHKGIAEGSQCLGYHMWT
FIDNWSWSNAYKNRYGFVQLDLATQTRTVKKSGEWFAVVAAENGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatcatcttcagaacgattttcgctttcccgcgaatttttggtggggcagcgcc
agttcggcaccgcaaacggaaggcgaaagcctcagctatggtaaaagtgccaccgtgtgg
gacgaatggtttgccacgcagcccggccgctttcaccagcaggtggggccggcagatacc
tccacgttttatcagcactggcgtgaagatattgcgctgctgaaggcgttgaatcacaac
acgttccgaacgtcgatctcctgggcgcggctgatacctgatggcgttggtgagcctaat
ccgcaggcggtggcgttttataatcagatcattgatgaaatgctggcgcagggcatcacg
ccgtttatcaatttgttccattttgatatgccgatggtgatgcagcggttgggcggctgg
gaaaatcgggcggtggtcgtggcctatgcgggctatgcggcgacctgcttccgcctgttt
ggcgacagggtaaaacactggtttacgttcaatgagccggtggtgccggtggaaggcggg
tatctgtatgatttccactatccgaatgtggtggatttcaagcgtgctgcgacggtggcg
taccacaccatgctggcgcatgcgctggcggtgaaagcctaccgcgaacagtcgcaggat
ggggaaattggcattatcctcaatttgacgccttcctatccgcgctcgcaacatccggcc
gatgtcaaagccgctaacattgccgatctgatgtttaatcgcagctttctcgatcccgcc
ctgaaaggggaatacccgcaggaattggtcgatctgctgcatcgctatggccaactgccg
tcttgccagcctgacgatcgtgcgctgctggccgatggtgttgtcgatctgctggggatt
aactattaccagccgcgtcgtattcagtgccgcgacagtctggtgaatcccgatagtccg
tttatgcctgagtggttcttttccagctacgagatgccgggacgaaaaatgaacccctat
cgtggttgggaaatttacgaaccgggcatctatgacattctgactaacctgcgggtgaac
tacggcaatccgcgctgctttatttcagaaaacggcatgggggtggagagcgaacagcgt
ttcgacgccaacggccagattcaggatgattaccgcatcgattttgtccgtgaacacctg
aaatatgtacacaaaggcatcgcggaaggtagccaatgcctcggctaccatatgtggacg
tttatcgataactggtcgtggtcgaatgcctacaagaatcgctatggtttcgtgcagttg
gatttggcgacgcagacgcgcacggtgaagaaaagcggtgaatggttcgcggtcgtggct
gccgagaatggcttttga

DBGET integrated database retrieval system