KEGG   Pectobacterium wasabiae: Pecwa_0071Help
Entry
Pecwa_0071        CDS       T01106                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pwa  Pectobacterium wasabiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pwa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(81173..82288)
Genome map
AA seq 371 aa AA seqDB search
MPHVLRYLIPMLLWLWVSVAAAAVCDWPAWEQYKQHYISEQGRVIDTTSPNKITTSEGQS
YAMFFALVANDREMFERLRQWTENNLSAGDLGANLPAWLWGESKDKQWTVLDPNSASDAD
LWIAYNLLEAGRLWKDTRYKTLGTTLLKRIAREEVVNIPGLGMMLLPGKVGFTEKESWRL
NPSYLPPQLLARFAPLGETWKSMQRTTQRLLLETAPKGFSPDWVIWQKDKGWQPDTTKPN
IGSYDAIRVYLWVGMMADSSRGKADLIKQFQPMIQQTVQQGLPPEKTDTATGAVTGQGSV
GFSASLLPMLSRQPDALTIQRQRLAADPPGDDAYFSASLTLFGQGWDEKRYRFTSQGQLL
PSRGSQCITTP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgtgctgcgctacctgatccccatgctgctgtggctatgggtctccgttgcc
gccgcagccgtttgcgactggcccgcctgggaacagtacaaacagcattacatcagcgag
caagggcgggtgattgataccacctcccccaataaaatcaccacttccgaagggcaaagt
tacgccatgttctttgccctggtcgccaacgatcgagaaatgtttgagcgactgcggcaa
tggacggaaaacaacctgtctgctggcgatttaggggccaatctgcccgcctggctatgg
ggagaaagcaaagataaacagtggacggtgctagaccctaactccgcgtccgacgccgat
ctgtggatcgcctataacctgcttgaagcgggccgactgtggaaagatacccgctataaa
acgctgggcaccacgctgcttaaacgaattgccagggaagaggtcgttaatattccgggt
ctgggcatgatgctcttgcccggcaaagtcggtttcacagagaaagagagctggcgttta
aaccccagttacctgccgccgcaattgctggcccgctttgcgccgttgggtgaaacgtgg
aagagcatgcagcgcaccacgcagcgcctgctattggaaaccgcaccgaaaggattttcg
cctgattgggtcatctggcaaaaagacaaaggctggcagcccgataccacaaaacccaat
atcggcagctatgacgccattcgcgtctatctgtgggtagggatgatggccgatagcagc
agaggaaaagccgacttgatcaaacagtttcagcccatgattcaacagacggtccaacaa
gggttgccacctgaaaaaacggacacggcaacaggtgccgtcaccgggcagggatcggta
ggattttccgcctcgctgctcccaatgctatcccgtcagccggatgcgttgaccatccag
cgacaacggctcgccgcggatccaccgggtgacgatgcctatttctcggcttctctgacg
ctctttggtcagggatgggatgagaagcgctaccgcttcacgtcacaaggccaactttta
ccgtcgcggggcagccaatgcataacaacaccgtaa

DBGET integrated database retrieval system