KEGG   Pectobacterium wasabiae: Pecwa_0138Help
Entry
Pecwa_0138        CDS       T01106                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pwa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pwa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pwa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pwa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pwa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pwa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pwa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
163114..164076
Genome map
AA seq 320 aa AA seqDB search
MIRRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEIYGIYDGYQGLYEDRMEQLDRYSVSD
VINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKGDWLDTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaatcggagtgttgacgagcggtggcgatgcaccaggtatgaatgcggca
attcggggtgtggttcgtgctgcactgtctgaagggctggagatctacggcatttatgat
ggttatcagggcttgtacgaagatcgcatggagcagttagatcgctacagcgtatcggat
gtgattaaccgtggcggtacgttcctcggttcagcgcgtttcccgcagttccgtgacgaa
gccgtgcgtcaggtgtgtgtggaaaacatgaagagacgcggcctggatgcactggtcgtt
atcggcggtgacggttcctatatgggtgccaaacgtctgacggaaatgggttttccctgt
atcggcctgcccggcacgatcgataacgacgtagcgggaacggactacaccatcggttac
tttaccgcgctggaaaccgtgctggaagcgattgaccgcctgcgagatacctcctcttct
caccaacgtatttctattgttgaagttatgggacgccactgcggcgacctgacgctggcg
gcagcgattgccggtggctgtgaattcatcgtcctgccggaagtgccgttcagcccggaa
gatctggtctgcgaaatcaaagcgggcatcgagaaaggtaaaaagcacgcgattgtcgcg
attaccgagctggtgtgcgacgtcgatgaactggcgaaatatattgaaaaagaaacgggg
cgcgaaacccgtgcaactgtactcggccacattcagcgcggcgggtcgccggtcgcgtat
gaccgcattctggcctctcgcatgggcgcatactcgattgaattgctacagcagggctac
ggtggccgctgtgtcggtatccagaatgagaaaatggtgcatcatgacatcgtcgatgcc
atcgagaacatgaaacgtccgttcaaaggcgactggttggatacggcgaaaaaactgttc
tga

DBGET integrated database retrieval system