KEGG   Pectobacterium wasabiae: Pecwa_0138Help
Entry
Pecwa_0138        CDS       T01106                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pecwa_0138
   01230 Biosynthesis of amino acids
    Pecwa_0138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0138
   00030 Pentose phosphate pathway
    Pecwa_0138
   00051 Fructose and mannose metabolism
    Pecwa_0138
   00052 Galactose metabolism
    Pecwa_0138
  Energy metabolism
   00680 Methane metabolism
    Pecwa_0138
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pecwa_0138
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pecwa_0138
Protein phosphatases and associated proteins [BR:pwa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pecwa_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
163114..164076
Genome map
AA seq 320 aa AA seqDB search
MIRRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEIYGIYDGYQGLYEDRMEQLDRYSVSD
VINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKGDWLDTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaatcggagtgttgacgagcggtggcgatgcaccaggtatgaatgcggca
attcggggtgtggttcgtgctgcactgtctgaagggctggagatctacggcatttatgat
ggttatcagggcttgtacgaagatcgcatggagcagttagatcgctacagcgtatcggat
gtgattaaccgtggcggtacgttcctcggttcagcgcgtttcccgcagttccgtgacgaa
gccgtgcgtcaggtgtgtgtggaaaacatgaagagacgcggcctggatgcactggtcgtt
atcggcggtgacggttcctatatgggtgccaaacgtctgacggaaatgggttttccctgt
atcggcctgcccggcacgatcgataacgacgtagcgggaacggactacaccatcggttac
tttaccgcgctggaaaccgtgctggaagcgattgaccgcctgcgagatacctcctcttct
caccaacgtatttctattgttgaagttatgggacgccactgcggcgacctgacgctggcg
gcagcgattgccggtggctgtgaattcatcgtcctgccggaagtgccgttcagcccggaa
gatctggtctgcgaaatcaaagcgggcatcgagaaaggtaaaaagcacgcgattgtcgcg
attaccgagctggtgtgcgacgtcgatgaactggcgaaatatattgaaaaagaaacgggg
cgcgaaacccgtgcaactgtactcggccacattcagcgcggcgggtcgccggtcgcgtat
gaccgcattctggcctctcgcatgggcgcatactcgattgaattgctacagcagggctac
ggtggccgctgtgtcggtatccagaatgagaaaatggtgcatcatgacatcgtcgatgcc
atcgagaacatgaaacgtccgttcaaaggcgactggttggatacggcgaaaaaactgttc
tga

DBGET integrated database retrieval system