KEGG   Pectobacterium parmentieri WPP163: Pecwa_0138Help
Entry
Pecwa_0138        CDS       T01106                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00030  Pentose phosphate pathway
pwa00051  Fructose and mannose metabolism
pwa00052  Galactose metabolism
pwa00680  Methane metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
pwa01230  Biosynthesis of amino acids
pwa03018  RNA degradation
Module
pwa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0138
   00030 Pentose phosphate pathway
    Pecwa_0138
   00051 Fructose and mannose metabolism
    Pecwa_0138
   00052 Galactose metabolism
    Pecwa_0138
  Energy metabolism
   00680 Methane metabolism
    Pecwa_0138
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pecwa_0138
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pecwa_0138
Protein phosphatases and associated proteins [BR:pwa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pecwa_0138
Messenger RNA biogenesis [BR:pwa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pecwa_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACX86005
JGI: Pecwa_0138
UniProt: D0KDG9
Position
163114..164076
Genome map
AA seq 320 aa AA seqDB search
MIRRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEIYGIYDGYQGLYEDRMEQLDRYSVSD
VINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKGDWLDTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaatcggagtgttgacgagcggtggcgatgcaccaggtatgaatgcggca
attcggggtgtggttcgtgctgcactgtctgaagggctggagatctacggcatttatgat
ggttatcagggcttgtacgaagatcgcatggagcagttagatcgctacagcgtatcggat
gtgattaaccgtggcggtacgttcctcggttcagcgcgtttcccgcagttccgtgacgaa
gccgtgcgtcaggtgtgtgtggaaaacatgaagagacgcggcctggatgcactggtcgtt
atcggcggtgacggttcctatatgggtgccaaacgtctgacggaaatgggttttccctgt
atcggcctgcccggcacgatcgataacgacgtagcgggaacggactacaccatcggttac
tttaccgcgctggaaaccgtgctggaagcgattgaccgcctgcgagatacctcctcttct
caccaacgtatttctattgttgaagttatgggacgccactgcggcgacctgacgctggcg
gcagcgattgccggtggctgtgaattcatcgtcctgccggaagtgccgttcagcccggaa
gatctggtctgcgaaatcaaagcgggcatcgagaaaggtaaaaagcacgcgattgtcgcg
attaccgagctggtgtgcgacgtcgatgaactggcgaaatatattgaaaaagaaacgggg
cgcgaaacccgtgcaactgtactcggccacattcagcgcggcgggtcgccggtcgcgtat
gaccgcattctggcctctcgcatgggcgcatactcgattgaattgctacagcagggctac
ggtggccgctgtgtcggtatccagaatgagaaaatggtgcatcatgacatcgtcgatgcc
atcgagaacatgaaacgtccgttcaaaggcgactggttggatacggcgaaaaaactgttc
tga

DBGET integrated database retrieval system