KEGG   Pectobacterium parmentieri WPP163: Pecwa_0169Help
Entry
Pecwa_0169        CDS       T01106                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00051  Fructose and mannose metabolism
pwa00562  Inositol phosphate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
pwa01230  Biosynthesis of amino acids
Module
pwa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pwa_M00002  Glycolysis, core module involving three-carbon compounds
pwa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0169
   00051 Fructose and mannose metabolism
    Pecwa_0169
   00562 Inositol phosphate metabolism
    Pecwa_0169
Enzymes [BR:pwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pecwa_0169
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pecwa_0169
  Exosomal proteins of bladder cancer cells
   Pecwa_0169
  Exosomal proteins of melanoma cells
   Pecwa_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACX86024
JGI: Pecwa_0169
UniProt: D0KDI8
Position
complement(182421..183188)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLDQANHQLAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFGVLKDAG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVVAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAADAKRG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagcactcacatggtcaat
gaactgatcgcgggtctgcgtaaagaactcagcaccgttgacggttgtggcgtagccatt
gcaccacctgctatctacctcgatcaagctaatcaccaactggcgggaagccgtattgca
ctgggcgcgcagaacgttgacgtgaatctttctggtgctttcacaggtgaaacctctgct
gaaatgctgaaagatatcggtgcgaaatacatcatcatcggccactctgagcgccgtacc
taccacaaagaaagtgatgaattcattgcgaagaaatttggcgtgctgaaagatgcgggc
ctgatcccagtactgtgcattggcgaaacggaagcagaaaacgaagcaggccagaccgaa
gccgtgtgcgcacgtcaactggatgccgtgttgaatacgctgggcgcaaaagcgtttgaa
aacaccgtggtggcctacgagccagtatgggccatcggtaccggcaaatctgcaactccg
gcacaggctcaggccgttcacaaattcatccgtgaccacatcgccaagcaagatgctgct
gttgctgaacaagtgatcatccagtacggcggttcagttaatgcggcgaatgcggcagag
ctgtttacccagccggacatcgacggcgcgctggttggcggtgcatcactgaaagctgac
gcctttgctgtcatcgtgaaagcggcagccgacgctaagcgcggctaa

DBGET integrated database retrieval system