KEGG   Pectobacterium wasabiae: Pecwa_0822Help
Entry
Pecwa_0822        CDS       T01106                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pwa  Pectobacterium wasabiae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pecwa_0822 (deoA)
Enzymes [BR:pwa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Pecwa_0822 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
871840..873168
Genome map
AA seq 442 aa AA seqDB search
MFLIQEIIRKKRDGKALSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALT
LAMRDSGTVLDWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGLDIFPNDDHFRRIIQQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEQLAQAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLAGEHRNPRLYDVTMALCSEMLLAGGLASSADDAHSRL
QAVLDNGKAADVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFAAREGIVTAMDTRALG
MAVVSLGGGRRQATDTIDYSVGLDSMISLGERVDAQRPLAVIHANTEAQWQQAANEVRAA
IQLGDTAPEKTPMVYRRVSTEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaagaaattattcgtaagaagcgtgatggaaaagcgctgagtgaagaa
gagatccgcttttttatcaacggtattcgtgacaacaccgtctctgaaggccagatcgcc
gctctcgcgatgaccatttattttcacgacatgtcgatggacgagcgggtggcgctgacg
ttggcgatgcgtgattctggcacggtgctggactggaagagcctgaacctgaacggcccg
ctggtggacaaacactctaccggtggcgtgggcgatgtgacctcgctgatgctagggcca
atggtcgccgcctgtggggggtatgtcccgatgatctctggacgcggcttagggcatacc
ggtggcacgttagataagttagaagcgatacctggactggatatttttccgaacgatgac
cattttcgtcgcatcatccagcaggttggcgtcgcgattattgggcagacctcatcgctg
gctccggcggataaacgcttttacgccacgcgtgacattaccgccactgttgattcgatc
ccattgatcaccgcgtcgattctggcgaaaaaattggccgaaggactggatgcgttagtg
atggacgtcaaagtcggttccggggcgtttatgccgacctatgaactgtccgaacaactg
gcgcaggcgattgtcggcgtggcgaataatgcgggatgtcgcaccagcgccttgctgacg
gacatgaatcaggtgctggcctccagcgcggggaatgcgctggaagtgcgagaagccgtg
cgcttcctggcgggagagcaccgtaatccgcgtctgtatgatgttactatggcgctatgt
agcgagatgctgctagcgggcgggctggcaagctcggcggacgatgcacattcacgtttg
caggccgtattggataatggtaaagccgccgatgtctttggccgcatggttgctgcacag
cgtggaccgggggattttgtcgaacactacgatcgctacctgccggtggcgacgttaagt
aagccggtgttcgcagcgcgtgaaggcattgtgaccgcgatggatacccgtgcgttggga
atggcagtcgtatcgctgggcggcggacgccgtcaggccacagatacgatcgattacagt
gtcggtctggatagcatgattagcttgggtgagcgggttgacgcacagcgaccgctggcg
gtgatccacgccaatacagaagcgcaatggcagcaggcggcgaatgaagtccgagccgcg
atccaactgggtgacactgcgccggaaaagaccccgatggtttatcgtcgggtgagtacg
gaagcgtga

DBGET integrated database retrieval system