KEGG   Pectobacterium parmentieri WPP163: Pecwa_0914Help
Entry
Pecwa_0914        CDS       T01106                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00620  Pyruvate metabolism
pwa00640  Propanoate metabolism
pwa00680  Methane metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0914
   00620 Pyruvate metabolism
    Pecwa_0914
   00640 Propanoate metabolism
    Pecwa_0914
  Energy metabolism
   00680 Methane metabolism
    Pecwa_0914
Enzymes [BR:pwa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pecwa_0914
Lipid biosynthesis proteins [BR:pwa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pecwa_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACX86732
JGI: Pecwa_0914
UniProt: D0KIB0
Position
complement(982198..984159)
Genome map
AA seq 653 aa AA seqDB search
MTQHNKHAIPAAIAENALINAQQYENMYRLSVDDPATFWGEQGKIVDWIKPYETIKNTSF
DPGHIRIRWFEDGTLNVAANCLDRHLAERGDQTAIIWEGDDATESKKVTYRELHQSVCRF
ANVLKSQGVKKGDVVAIYMPMVPEAAVAMLACARVGAIHSVIFGGFSPEAISGRIIDSSA
KLVITADEGVRAGRVIPLKKNIDEALKNPNVTTISSVIVFRRTGKSGEWKDGRDLWWHDL
VEKADDHCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPTWPDASRMAQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTSRESLRIMGSVGEPINPEAWEWYFNKIGNGKCPIVDTWWQTETGG
FMITPIPGAIEAKAGSATRPFFGVQPALVDNLGNPQEGTSEGNLVIVDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHHMKGQAIYAYITLNHGEEPSSELYTEVRNWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAMSTASQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacataataaacacgccattcccgccgctattgcggaaaatgcactgattaat
gcccagcaatacgaaaatatgtatcggctgtccgttgacgatcccgccaccttttggggt
gagcagggaaagatcgtcgattggatcaaaccctatgaaacgatcaagaacacctcattc
gacccaggccacatccgtattcgctggtttgaggacggtacgcttaatgtggcagcaaac
tgtctggaccgccatctggccgagcgtggcgatcaaaccgccattatttgggaaggcgat
gacgcaacagaaagtaagaaagttacctatcgagagctgcaccaatctgtgtgccgcttc
gccaatgtactgaagtcgcagggcgtcaagaaaggcgatgtcgttgccatttatatgccg
atggtgccggaagcggctgtggcaatgctggcctgtgccagagtcggcgcgattcactcg
gtgatcttcgggggcttctctcccgaagcaatttccgggcgtatcatcgactccagcgcc
aaactcgttatcaccgctgatgaaggcgttcgcgccgggcgtgtgattccgctgaagaag
aatattgatgaggcgttaaagaacccaaatgtcaccaccatttccagcgtcatcgttttc
cgtcgcacgggaaagagcggtgaatggaaagatgggcgcgatctgtggtggcacgatctg
gttgaaaaagcagacgaccattgcccaccagaagagatgaatgcggaagatccgctgttt
atcctttatacatcgggttcaaccggcaaacccaaaggtgtattgcataccactggcggc
tatctggtttatgccgcactgaccttcaagtatgtcttcgactaccatcctggcgacatc
tactggtgcacggcagacgttggctgggttacagggcatagctacctgctttatggcccg
ctggcgtgtggcgcgattacgctgatgtttgaaggcgtgccaacctggccagatgccagc
cgtatggcacaagtagtcgataaacataaggtcaacattctctataccgcccctactgca
attcgcgcgctgatggctgaaggtgacaaggcgatcgagggcacatcgcgtgaatcgctc
aggatcatggggtctgttggtgagccgatcaacccggaagcctgggagtggtatttcaac
aaaatcggcaatggcaaatgcccgattgtcgatacctggtggcaaacggaaacgggcggc
ttcatgatcaccccgatccccggcgcaatcgaagcaaaagccggttccgcgacgcgtcca
ttcttcggtgtacagcctgcgctagtcgacaatctcggcaatccacaggaaggtaccagc
gaaggcaatctggtgattgtggattcctggccgggtcaggcaaggacgctgtttggcgat
cacgatcgctttgagcaaacctacttttccactttcaaaggcatgtatttcagcggcgac
ggcgcgcgccgtgacgaggatggctattactggatcacgggtcgtgttgacgacgtgctg
aacgtttccggccaccgtctgggaacggcagaaatcgagtctgcgctcgttgcccatccc
aagattgctgaagcagccgtggtcggtatcccgcaccatatgaaaggacaggctatttac
gcctatatcacactaaaccacggcgaagagccgtccagcgaactgtatacggaagtgcgc
aactgggtgcgtaaggaaatcggcccgattgctacgcctgacattctgcactggacagac
tccttaccgaaaacgcgatccggcaaaattatgcgtcgtattttgcgtaagatcgccgcc
ggtgacaccagcaacctgggggacacctcaacgctggccgatcctggcgtcgtcgaaaaa
ctgctcgaagaaaagcaggccatgagtaccgcctctcaatag

DBGET integrated database retrieval system