KEGG   Pectobacterium wasabiae: Pecwa_0988Help
Entry
Pecwa_0988        CDS       T01106                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pecwa_0988
   01230 Biosynthesis of amino acids
    Pecwa_0988
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_0988
   00051 Fructose and mannose metabolism
    Pecwa_0988
   00562 Inositol phosphate metabolism
    Pecwa_0988
Enzymes [BR:pwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pecwa_0988
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pecwa_0988
  Exosomal proteins of bladder cancer cells
   Pecwa_0988
  Exosomal proteins of melanoma cells
   Pecwa_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1062768..1063592
Genome map
AA seq 274 aa AA seqDB search
MKKVMIGTSWKMNKTRQEAIDYCTVLSKQLNPAAGAFTQPFVIPPFTLIREVTEYLSAHK
VNCLTGAQNMHYADNGAWTGEVSPMMVSDCGATLVELGHSERRQYFAENDADIQKKVQAA
LRYQLRPLVCVGDSAQEKAWGVSRETVIRQMKIALAGLNAEQATRVIIAYEPIWAIGEGG
TPASAQEAQDIHVALRQALVALYGERTASCITLLYGGSVNPHNTCELIQCADIDGLFIGR
AAWNADDFCQLVRSVSALLNEQGEHVALSEAKMS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgatgataggcacgagttggaaaatgaataaaacccgacaggaggcgatc
gactactgtacggttctatccaaacagcttaaccctgctgccggtgcattcactcagccc
tttgtgattcccccttttaccttgataagggaagtgaccgagtatctgtctgcgcacaag
gtgaattgcctgacaggggcgcaaaatatgcattacgctgacaacggcgcgtggaccgga
gaggtgtctccgatgatggtatctgattgcggtgcgacgcttgtcgaactgggacattcc
gagcggcggcaatatttcgcagaaaatgatgcggatatccagaaaaaagtgcaggccgca
ctacgctatcagttgcgcccgttagtttgcgtgggtgacagtgcacaagagaaggcgtgg
ggtgtttccagagaaacggtcattcggcaaatgaaaattgcgcttgcaggcttaaatgcg
gaacaggcgacacgtgtcatcatcgcctatgaacccatctgggccattggtgaaggaggg
acgccagcttccgcacaggaagcgcaggatattcatgtcgcgttgcgccaggcgttagtt
gccctttatggcgaaagaacggcttcctgtattacgcttctgtacggcggaagcgtgaat
ccgcataatacctgtgaacttattcaatgtgcagatattgacgggttatttatcggcagg
gccgcctggaatgcggatgacttctgccaactggtgcgcagtgtttcggcattgttgaat
gaacagggtgaacacgtggccctaagcgaagccaaaatgagttaa

DBGET integrated database retrieval system