KEGG   Pectobacterium wasabiae: Pecwa_1144Help
Entry
Pecwa_1144        CDS       T01106                                 

Definition
DNA polymerase III subunit epsilon (EC:2.7.7.7)
Orthology
K02342  
DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
pwa  Pectobacterium wasabiae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pecwa_1144
   00240 Pyrimidine metabolism
    Pecwa_1144
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pecwa_1144
   03430 Mismatch repair
    Pecwa_1144
   03440 Homologous recombination
    Pecwa_1144
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pecwa_1144
DNA replication proteins [BR:pwa03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pecwa_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1237454..1238191
Genome map
AA seq 245 aa AA seqDB search
MSTEITRQIVLDTETTGMNKLGVHYEGHKIIEIGAVEVINRRLTGRHFHVYIKPDRLVDP
EAYNIHGISDEFLADKPTYADIADDFLDFIRGAELVIHNATFDIGFMDYEFRLLNRDLPK
TETFCKITDSLFMARKIFPGKRNSLDALCDRYLIDNSKRTLHGALLDAEILAEVYLAMTG
GQTSLTFSMDGETQQQNENSETIQRIVRPQSALTVLYADEVELLAHEQRLDLIAKKGGSC
LWRAE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaattacgcgacaaatcgtcctggatacagaaaccactggtatgaataag
ctgggggttcactacgaaggacataaaattatcgagatcggtgcggtcgaagtgattaac
cgccgactgactggccgtcattttcacgtctacatcaaacccgatcgtctagtggatcca
gaggcctataacatccatggtatcagcgatgagttccttgctgataaaccgacgtatgct
gatattgcagatgattttctcgattttatccgtggtgcggagttggtcattcataacgcg
acgtttgatatcggctttatggattatgagtttcgattgctgaatcgggatcttcccaag
acggagacgttctgtaagatcaccgatagcctgtttatggctcgaaagatcttccctggt
aaacgtaacagcttggatgcgctctgcgatcgctatttgatagacaacagcaagcgtacg
ttgcacggcgcattgctcgatgccgagattctggcagaagtttatctggcgatgaccggc
ggtcaaacgtctctgactttttcgatggacggtgaaacacagcagcagaatgagaatagt
gaaacgatccaaagaattgtccgcccacaatcggcgctaacggtgctttatgcagacgag
gtcgagctgctagcgcatgaacaacgcttggatctgattgctaaaaaagggggcagttgt
ctgtggcgggcagaataa

DBGET integrated database retrieval system