KEGG   Pectobacterium wasabiae: Pecwa_1228Help
Entry
Pecwa_1228        CDS       T01106                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pwa  Pectobacterium wasabiae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pecwa_1228
   00500 Starch and sucrose metabolism
    Pecwa_1228
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Pecwa_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1340331..1341437)
Genome map
AA seq 368 aa AA seqDB search
MINASHFGKTLTLAMLISSPWTLAQAADYNALVSANATDAKAYKTITEAIASAPADSSPF
VIYVKNGVYHERLTITRPNIHLQGESRDGTVIAATTAAGMLKPDGSKWGTYGSNTVKVDA
PDFSARSLTISNDFDYPANQAKASDDPTKLKDSQAVALLVAENSDRAWFHDVSLTGYQDT
LYVKGGRSFFSKCRISGTVDFIFGNGTALFDDCDIVARNRTDVKDQPLGYLTAPSTDIKQ
KYGLVIINSRVIKEKDVPAKSYGLGRPWHPTTTFEDGRYADPNAIGQTVILNTSMDDHIY
GWDKMSGKDKQGEKIWFHPQDSRFFEYKSSGTGAEKNEQRRQLSEAEAAEYTTDKVLAGW
VPTAPKGK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcctcacacttcggcaagacgctgactttagccatgttaatttcctcacct
tggacgttagcacaggcagccgactacaatgcgctggtttccgccaatgcaacggacgcc
aaagcctataaaaccattactgaggctatcgccagcgccccggcagacagttccccattt
gttatctatgtgaaaaatggcgtgtaccacgagcgcctcacgattacgcgccccaacatc
catctacaaggcgaaagtcgtgacggtacagtgatcgccgcaaccaccgccgctggaatg
ctcaaacccgatggcagcaaatggggaacctatggcagcaacacggtgaaagtcgatgca
cccgatttcagcgcccgttcgctaaccatcagcaacgatttcgattacccagccaatcag
gccaaagccagtgatgacccgaccaaattaaaagattcgcaggccgttgcgctgctggtt
gccgaaaatagcgatcgtgcgtggttccatgatgtcagcctgaccggctaccaggacacg
ctgtatgtgaaaggtgggcgcagcttcttctcaaaatgccgtatcagcggcaccgttgat
ttcatctttggcaacggcactgcgctgtttgacgattgtgacattgtcgctcgtaatcgt
accgacgtgaaagatcaaccacttggttacctcaccgcccccagcactgacattaagcaa
aaatatggtttggtcattattaatagccgggtgattaaagagaaagatgtgcccgcaaaa
agctatggtttgggccgcccttggcacccaacaaccacctttgaggacggtcgttatgcc
gatcctaacgccatcggccagaccgttatcctgaacaccagcatggacgatcacatctat
ggctgggacaaaatgtcaggcaaagataaacaaggcgaaaaaatctggttccatccgcag
gactcgcgcttttttgagtacaaatctagcggtactggggcagagaaaaacgagcagcgc
cgtcagctaagcgaagcggaggcggcagaatacaccacagataaggtattagcaggttgg
gttcctactgcgcctaaagggaaataa

DBGET integrated database retrieval system