KEGG   Pectobacterium parmentieri WPP163: Pecwa_1288Help
Entry
Pecwa_1288        CDS       T01106                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00071  Fatty acid degradation
pwa00350  Tyrosine metabolism
pwa00625  Chloroalkane and chloroalkene degradation
pwa00626  Naphthalene degradation
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_1288
  Lipid metabolism
   00071 Fatty acid degradation
    Pecwa_1288
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pecwa_1288
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pecwa_1288
   00626 Naphthalene degradation
    Pecwa_1288
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pecwa_1288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACX87096
JGI: Pecwa_1288
UniProt: D0KK39
Position
complement(1399958..1400968)
Genome map
AA seq 336 aa AA seqDB search
MKAAIVTKDHSVEIQDKKLRPLQHGEALLKMECCGVCHTDLHVKDGDFGDVAGIILGHEG
VGVVKEIGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCREVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSQIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDAQLAFAKEVGADLVINPAKEDAAKIIQEKVGGAHATVVTAVARA
AFNSAVDSVRAGGRIVAVGLPPESMDLNIPRLVLDGIQVLGSLVGTREDLKEAFQFAAEG
KVKPKVTRRPLKDINAIFTEMKGGKITGRMVIDLSM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccatcgttacgaaggatcactccgttgaaattcaggacaaaaaactgcgc
cccctccagcacggagaagcactgctaaaaatggaatgctgtggcgtttgccacaccgat
ctacacgtcaaagacggcgattttggcgatgttgccggtatcatactcggccatgaaggt
gtcggtgtcgttaaagaaatcggtcccggagtgacctcactgaagcccggcgatcgcgcc
agcgtcgcctggttctatcagggttgcggccactgcgaatattgtaatagcggtaacgaa
acgctgtgtcgcgaggtaaaaaacgcgggctattccgttgatggcgggatggctgaagaa
tgtatcgtcgttgccgactatgcggtaaaagtaccggatggtctggattctgcggctgcc
agcagcattacctgcgcgggagtgacaacgtacaaagcggtgaaagtctcgcaaatcaag
ccgggacagtggatcgccatttatggtctgggtggattgggtaatctggcgttgcaatat
gccaaaaacgtctttaatgcgaaagtcattgcgattgatgtgaatgacgcacagttagcc
tttgccaaagaagtgggagcagacctggtcatcaatccagccaaagaagatgccgccaag
atcattcaggaaaaagtgggcggcgcacatgcgaccgtggtcaccgccgttgcacgcgca
gcatttaactcagccgtggattccgttcgcgcaggtgggcgtattgtcgccgtcggcctg
ccaccagaatctatggatctgaatattccgcgtctggtgttggatggcattcaggtatta
ggctcgctggtcggcacgcgtgaagatctgaaagaagcattccaatttgcggccgaaggg
aaagtgaaaccgaaggtcacccgccgtccactgaaagatatcaacgcgattttcactgaa
atgaaaggcgggaaaatcaccggccgtatggtgatcgacctgtcaatgtaa

DBGET integrated database retrieval system