KEGG   Pectobacterium parmentieri WPP163: Pecwa_1317Help
Entry
Pecwa_1317        CDS       T01106                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pecwa_1317
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pecwa_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Cellulase Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ACX87122
JGI: Pecwa_1317
UniProt: D0KKJ5
Position
complement(1434813..1436873)
Genome map
AA seq 686 aa AA seqDB search
MFKFPPLSSKVPVLLHGADYNPDQWLDNPEVLEKDIEMMKQTQCNVMSVGIFSWSGIEPE
EGRYEFGWLDGILDMLHANGIFVFLATPSGARPAWLSQKYPDVLRVGSNRVRALHGGRHN
HCLSSPNYREKVKQMNTQLAKRYSHHPAVIGWHISNEYSGECHCDTCRSTFQSWLKARYG
TLEALNKAWWSTFWSHTYTDWSQLEPPSPIGEVSIHGLNLDWKRFNTSQVSDFCAAEIAP
LKAENPSLPTTTNFMEYFYDYDYWQLAKVIDFISWDSYPLWHNAEDDCTLGAYTAMYHDL
MRTLKGGKPFYLMESTPSLTNWQPISKLKKPGMHILSSLQAVAHGSDSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVQELGDILNKLAPVAGSRVDAKVAIIFDWESRWAMDNA
QGPRNAGLFYEKTVTDHYRTFWEQGVAVDIINADVDLSGYQVVIAPMLYMVRDGFAERVD
AFVKQGGRFVTTYWSGVVNDTDLCYQNGFPGPLRPIMGIWAEEIDGLYDHESNSISGLTG
NEQRLAGPYQVTHLCELIHLEGARALATYDSDFYAGRPAVTVNDYGKGQAYYIASRNDLA
FQRDFFTTLIQTLDLPRALPIDLPYGIVAHRRDDGESEFIFVQNYTATPQHITLPAVYEE
MTTGSTLSGALDLSGYGCRILRRALQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattccccccattaagcagcaaggtgcctgttctgctgcacggtgcagactat
aatccagaccaatggctggacaacccagaggtattggaaaaagacatcgagatgatgaag
cagacccagtgcaacgtcatgtccgtgggcatttttagctggtccgggattgagccggaa
gaaggtcgctacgaatttggctggctggatggcatcctcgacatgctgcatgccaatggg
atcttcgtttttctggcaacgcccagcggtgctcgtccggcctggctctcgcagaaatac
ccggacgtgctacgcgtgggtagcaatcgcgtgcgggcgctgcacggcggtcgtcacaac
cactgcctgagttcgccgaattatcgcgaaaaagtaaaacaaatgaacacccagttggca
aaacgctactcgcaccatcctgcggtgatcggctggcatatttccaacgaatacagcggc
gagtgccattgtgatacctgtcgcagcaccttccaaagctggttgaaagcccgctacggc
acgttagaggcgctgaataaagcgtggtggagcaccttctggagccacacctacaccgac
tggtcgcagttagaaccaccgtcacccatcggtgaagtctccattcacggcctgaatctg
gactggaaacgttttaacacctcacaggtcagtgatttttgtgccgccgaaattgcgccg
ctaaaagccgaaaatccgtcactgccaaccacgacgaacttcatggaatatttctatgat
tacgactactggcagttggcgaaggtgatcgatttcatctcctgggacagctacccgctg
tggcataacgcggaagatgactgcacgctgggtgcttacaccgcgatgtatcacgacctg
atgcgcacgctgaaaggtggcaagcccttctacctgatggaatcaacgccgagcctgacc
aactggcagccgatcagcaaactgaaaaagccgggtatgcatatcctgtcttcgcttcag
gccgtcgcgcacgggtcagactccgtgcagtatttccagtggcgtaagagccgcggttcc
gtcgagaaattccacggtgccgtcgtcgatcatgtcgggcatatcgacacccgtgtcggg
cgcgaagtacaggagttgggtgacatactcaataaactcgctcctgtcgcaggcagcagg
gtcgatgcgaaagtcgccatcattttcgactgggaaagccgctgggcgatggataatgct
caagggccgcgcaatgcggggctgttctatgaaaaaaccgtcaccgatcactatcggacg
ttctgggaacagggcgtggcggtggacatcattaacgccgatgtcgacctcagcggttat
caggttgtgattgcaccgatgctctacatggtgcgcgatggttttgccgaacgcgtcgat
gctttcgtcaaacaaggtggccgcttcgtcactacctactggtctggtgtcgttaacgac
accgatctgtgctaccaaaacggtttccccggtccgctgcgccctatcatgggaatttgg
gcggaagaaatcgacggactgtacgatcatgaaagcaacagtatcagcggtctgacaggg
aatgaacaacgtctggccggcccgtatcaggtcactcacctgtgcgaactgattcatctg
gaaggcgcacgggcactagcgacctatgacagcgatttctatgccggacgcccagccgtg
acggtcaatgattacggcaaaggacaggcgtactacatcgcatcgcgcaacgatctcgcc
ttccagcgggatttcttcaccacgctgatacaaacgctggatctaccgcgcgcgctgcca
atcgatctgccttacggcattgtcgctcatcgtcgtgatgacggggaaagcgagtttatc
ttcgtacagaactacacggcaacgccgcagcacattacgctgcctgccgtttacgaggaa
atgacgacaggcagcacgctttcaggggcgctcgacctgtcaggctatggctgccggatc
ctacgccgcgcattacagtaa

DBGET integrated database retrieval system