KEGG   Pectobacterium wasabiae: Pecwa_1444Help
Entry
Pecwa_1444        CDS       T01106                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pwa  Pectobacterium wasabiae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pecwa_1444 (fadJ)
   01212 Fatty acid metabolism
    Pecwa_1444 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pecwa_1444 (fadJ)
   00650 Butanoate metabolism
    Pecwa_1444 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Pecwa_1444 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Pecwa_1444 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pecwa_1444 (fadJ)
   00310 Lysine degradation
    Pecwa_1444 (fadJ)
   00380 Tryptophan metabolism
    Pecwa_1444 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pecwa_1444 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pecwa_1444 (fadJ)
   00281 Geraniol degradation
    Pecwa_1444 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Pecwa_1444 (fadJ)
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pecwa_1444 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pecwa_1444 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pecwa_1444 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1565480..1567663
Genome map
AA seq 727 aa AA seqDB search
MNDQQPFLAATESPSAFSFTIRPDNIGVISIDIPGEKVNTLKREFAEQIISVFELARQHA
TLRGLIFISAKPDSFIAGADITMLNQCSSAEQAENLAKQGQETFDQIAALPFPVVAAIHG
ACLGGGLELALACDYRVCSLDEKTVLGLPEVQLGLLPGSGGTQRLPRLIGLDSALDLILT
GRHLRASQALRQGLVDEAVPHDILLDTAVEILKKGKRKTLPLNWRSRLLSSLGVRHLLFK
MVKRKTRAKTHGNYPATEKIIQVVRRGIEKGREEGYRQEARAFGKLVMTPESAALRHLFF
ASNALKKSAGAASDAKPIHRVGILGGGLMGGGIASVTAMRGQLPVRIKDINEQGINHALK
YNWQLLAKRVERKRMKPTECQRVMTLISGSTDYRGFEHADIVIEAVFEDLALKRQMVAEI
EEHAAPHTIFASNTSSLPIHQIAEGARRPQQVVGLHYFSPVDKMPLVEVIPHAHTSAETV
TTTVALARKQGKIAIVVGDSAGFYVNRILAPYINEAAYCLLEGEPVESIDHALVRFGFPV
GPLALLDEVGIDVATKIVPVLSEALGDRFTSPPAFDAILKDGRKGRKNGKGFYRYSKTHR
FWHAGKEVDSSVYPLLDVTPKAHIDPALISQRAVMMMLNEAARCLDEGVIQCARDGDIGA
VFGIGFPPFLGGPFHYMDRLGMETVVKTLLVLQQQYGDRFAPCERLLAMREGQRTFYPPA
DEDSRAS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaacagcctttcctcgcggcaacggaaagcccctctgctttttccttcacc
attcggccggataatatcggtgtgatcagcattgatatccccggtgagaaagtgaacacc
ttaaagcgcgaatttgcagaacagattatctcggtcttcgagttggcgcgacagcatgcg
acgctccgaggactcatttttatttccgccaagcctgattcgtttattgccggagcggat
atcaccatgttgaaccagtgcagcagcgccgaacaggcagaaaatctggcgaaacagggg
caggagacgttcgatcaaattgccgcgctacctttccccgtggtggctgccattcacggt
gcctgtctgggcggtgggttagaactggcattagcctgcgactatcgcgtttgctcgctg
gatgaaaagacggtgctggggcttccagaagtccagcttggccttcttcccggttcgggt
ggaacgcagcgcttgccacgcttgattggtctggatagcgcattggatctcatactgaca
ggtcgccatctccgcgcgagccaggcgctgcggcaagggctggtagatgaggcggtgccg
cacgatatcctgctggatacggcggtcgagatcctcaaaaaaggcaaaaggaagacgctc
ccgttgaactggcgttcgcgtctgctaagcagcctgggtgttcgtcatttgcttttcaaa
atggtgaaacgcaagactcgcgcgaaaacacacggcaactacccagccactgaaaagatt
attcaggtggtgcgacggggaatagaaaaaggccgtgaagaaggatatcggcaggaggcg
cgagcgttcggcaagctggtgatgacgccggagtctgctgcactgcgccatctgtttttc
gcctcgaatgcgttaaagaaaagcgcaggtgcggcctctgacgcaaagccgatccatcgc
gtcggcattctcggcggcggattgatggggggagggatcgccagtgtcacggcgatgcgc
gggcagttgccggtgcgtattaaagatatcaatgagcagggcatcaaccatgcattgaag
tacaactggcaactgctggccaagcgcgtcgagcgtaagcgaatgaaaccgacagagtgc
cagcgtgtgatgacgttgatttccggcagtacggactatcgtggttttgagcatgcggat
atcgtcattgaggcggtcttcgaagatttggcgctgaagcggcaaatggtggcggagatt
gaggagcatgccgcgccgcacacgatttttgcatcaaacacctcatcgttgccgatccat
caaatcgcagaaggcgcgcgacgtccacagcaggttgttggtctgcactattttagcccg
gtagataaaatgccactggttgaggtcattccccatgcacacactagcgcagagacggtc
acgacgacggttgctctggcgagaaagcagggaaaaatagcgattgttgtcggtgatagc
gccggtttttatgtaaaccgcatattggcaccttacatcaacgaagccgcgtactgcctg
ctggaaggggagccggttgaatcgattgaccatgcgctggtgcgttttggtttccctgtc
ggcccgctcgcactgcttgatgaagtcggtattgatgttgcaaccaagatcgtaccagtg
ctgagtgaagcactcggcgatcgctttacctccccgcccgcgtttgatgcgatcctgaaa
gatgggcgcaaagggcgcaagaatggcaaagggttctatcggtacagtaaaacgcatcgc
ttctggcacgcgggaaaagaggtcgatagttcggtttacccgctgctggatgtcacgccg
aaggcgcatatcgatcctgcgttaatcagccagcgtgccgtgatgatgatgttgaatgag
gcggcacgttgtctggatgaaggggtgattcaatgcgcccgtgacggcgatattggcgcg
gtatttggcattggtttcccccctttccttggtggcccattccactatatggatcgcctt
gggatggaaacggtcgtgaaaacgctgctggtgctgcaacaacagtatggcgatcggttc
gcgccctgtgaacgtttactcgcgatgcgggaaggccagcggacgttctatccgccagcc
gatgaagacagccgcgctagttga

DBGET integrated database retrieval system